Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial

Naoki Yuda,1 Miyuki Tanaka,1 Koji Yamauchi,1 Fumiaki Abe,1 Izumi Kakiuchi,2 Kyoko Kiyosawa,2 Mitsunaga Miyasaka,2 Naoki Sakane,3 Masahiko Nakamura4 1Food Ingredients and Technology Institute, Morinaga Milk Industry Co., Ltd., Zama, Kanagawa, Japan; 2Department of Nursing, Matsumoto Junior College, M...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Yuda N, Tanaka M, Yamauchi K, Abe F, Kakiuchi I, Kiyosawa K, Miyasaka M, Sakane N, Nakamura M
Formato:	article
Lenguaje:	EN
Publicado:	Dove Medical Press 2020
Materias:	humans mkp cognition cognitive dysfunction orientation alzheimer’s disease Geriatrics RC952-954.6
Acceso en línea:	https://doaj.org/article/023bfba7062f488391baa6e9b73c07d5
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:023bfba7062f488391baa6e9b73c07d5
record_format	dspace
spelling	oai:doaj.org-article:023bfba7062f488391baa6e9b73c07d52021-12-02T10:20:41ZEffect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial1178-1998https://doaj.org/article/023bfba7062f488391baa6e9b73c07d52020-05-01T00:00:00Zhttps://www.dovepress.com/effect-of-the-casein-derived-peptide-met-lys-pro-on-cognitive-function-peer-reviewed-article-CIAhttps://doaj.org/toc/1178-1998Naoki Yuda,1 Miyuki Tanaka,1 Koji Yamauchi,1 Fumiaki Abe,1 Izumi Kakiuchi,2 Kyoko Kiyosawa,2 Mitsunaga Miyasaka,2 Naoki Sakane,3 Masahiko Nakamura4 1Food Ingredients and Technology Institute, Morinaga Milk Industry Co., Ltd., Zama, Kanagawa, Japan; 2Department of Nursing, Matsumoto Junior College, Matsumoto, Nagano, Japan; 3Division of Preventive Medicine, Clinical Research Institute, National Hospital Organization Kyoto Medical Center, Kyoto, Japan; 4Matsumoto City Hospital, Matsumoto, Nagano, JapanCorrespondence: Naoki YudaFood Ingredients and Technology Institute, Morinaga Milk Industry Co., Ltd., 1-83, 5-Chome, Higashihara, Zama, Kanagawa, JapanTel +81 46 252 3051Fax +81 46 252 3017Email n-yuda@morinagamilk.co.jpBackground: Preventative measures have recently been taken to reduce the incidence of Alzheimer’s disease worldwide. We previously showed that Met-Lys-Pro (MKP), a casein-derived angiotensin-converting enzyme inhibitory peptide with the potential to cross the blood–brain barrier, attenuated cognitive decline in a mouse model of Alzheimer’s disease. However, the effect of MKP on cognitive function improvement in humans remains unknown. This exploratory study sought to investigate whether MKP intake could improve cognitive function in adults without dementia.Methods: A total of 268 community-dwelling adults without dementia participated in this 24-week randomized controlled trial. Participants were randomly allocated to the MKP (n = 134) or placebo (n = 134) group. The MKP group received four tablets daily, each containing 50 μg MKP, while the placebo group received four dextrin tablets containing no detectable MKP for 24 weeks. Scores on the Japanese version of the cognitive subscale of the Alzheimer’s Disease Assessment Scale (ADAS-cog) were used as the primary outcome to compare cognitive function between the MKP and placebo groups. The study products were also evaluated for safety.Results: The intention-to-treat analysis showed that there was no significant difference between the groups in terms of the ADAS-cog total score. Orientation, as measured by the respective ADAS-cog subscale, was significantly improved compared to placebo at 24 weeks post-MKP administration (P = 0.022). No serious adverse events due to MKP intake were observed.Conclusion: To the best of our knowledge, this is the first study to report the effects of MKP on human cognition. These preliminary results suggested the safety of daily MKP intake and its potential to improve orientation in adults without dementia. Further clinical studies are needed to confirm the present findings and the benefits of MKP on cognitive function.Keywords: humans, MKP, cognition, cognitive dysfunction, orientation, Alzheimer’s diseaseYuda NTanaka MYamauchi KAbe FKakiuchi IKiyosawa KMiyasaka MSakane NNakamura MDove Medical Pressarticlehumansmkpcognitioncognitive dysfunctionorientationalzheimer’s diseaseGeriatricsRC952-954.6ENClinical Interventions in Aging, Vol Volume 15, Pp 743-754 (2020)
institution	DOAJ
collection	DOAJ
language	EN
topic	humans mkp cognition cognitive dysfunction orientation alzheimer’s disease Geriatrics RC952-954.6
spellingShingle	humans mkp cognition cognitive dysfunction orientation alzheimer’s disease Geriatrics RC952-954.6 Yuda N Tanaka M Yamauchi K Abe F Kakiuchi I Kiyosawa K Miyasaka M Sakane N Nakamura M Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial
description	Naoki Yuda,1 Miyuki Tanaka,1 Koji Yamauchi,1 Fumiaki Abe,1 Izumi Kakiuchi,2 Kyoko Kiyosawa,2 Mitsunaga Miyasaka,2 Naoki Sakane,3 Masahiko Nakamura4 1Food Ingredients and Technology Institute, Morinaga Milk Industry Co., Ltd., Zama, Kanagawa, Japan; 2Department of Nursing, Matsumoto Junior College, Matsumoto, Nagano, Japan; 3Division of Preventive Medicine, Clinical Research Institute, National Hospital Organization Kyoto Medical Center, Kyoto, Japan; 4Matsumoto City Hospital, Matsumoto, Nagano, JapanCorrespondence: Naoki YudaFood Ingredients and Technology Institute, Morinaga Milk Industry Co., Ltd., 1-83, 5-Chome, Higashihara, Zama, Kanagawa, JapanTel +81 46 252 3051Fax +81 46 252 3017Email n-yuda@morinagamilk.co.jpBackground: Preventative measures have recently been taken to reduce the incidence of Alzheimer’s disease worldwide. We previously showed that Met-Lys-Pro (MKP), a casein-derived angiotensin-converting enzyme inhibitory peptide with the potential to cross the blood–brain barrier, attenuated cognitive decline in a mouse model of Alzheimer’s disease. However, the effect of MKP on cognitive function improvement in humans remains unknown. This exploratory study sought to investigate whether MKP intake could improve cognitive function in adults without dementia.Methods: A total of 268 community-dwelling adults without dementia participated in this 24-week randomized controlled trial. Participants were randomly allocated to the MKP (n = 134) or placebo (n = 134) group. The MKP group received four tablets daily, each containing 50 μg MKP, while the placebo group received four dextrin tablets containing no detectable MKP for 24 weeks. Scores on the Japanese version of the cognitive subscale of the Alzheimer’s Disease Assessment Scale (ADAS-cog) were used as the primary outcome to compare cognitive function between the MKP and placebo groups. The study products were also evaluated for safety.Results: The intention-to-treat analysis showed that there was no significant difference between the groups in terms of the ADAS-cog total score. Orientation, as measured by the respective ADAS-cog subscale, was significantly improved compared to placebo at 24 weeks post-MKP administration (P = 0.022). No serious adverse events due to MKP intake were observed.Conclusion: To the best of our knowledge, this is the first study to report the effects of MKP on human cognition. These preliminary results suggested the safety of daily MKP intake and its potential to improve orientation in adults without dementia. Further clinical studies are needed to confirm the present findings and the benefits of MKP on cognitive function.Keywords: humans, MKP, cognition, cognitive dysfunction, orientation, Alzheimer’s disease
format	article
author	Yuda N Tanaka M Yamauchi K Abe F Kakiuchi I Kiyosawa K Miyasaka M Sakane N Nakamura M
author_facet	Yuda N Tanaka M Yamauchi K Abe F Kakiuchi I Kiyosawa K Miyasaka M Sakane N Nakamura M
author_sort	Yuda N
title	Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial
title_short	Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial
title_full	Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial
title_fullStr	Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial
title_full_unstemmed	Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial
title_sort	effect of the casein-derived peptide met-lys-pro on cognitive function in community-dwelling adults without dementia: a randomized, double-blind, placebo-controlled trial
publisher	Dove Medical Press
publishDate	2020
url	https://doaj.org/article/023bfba7062f488391baa6e9b73c07d5
work_keys_str_mv	AT yudan effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT tanakam effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT yamauchik effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT abef effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT kakiuchii effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT kiyosawak effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT miyasakam effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT sakanen effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial AT nakamuram effectofthecaseinderivedpeptidemetlysprooncognitivefunctionincommunitydwellingadultswithoutdementiaarandomizeddoubleblindplacebocontrolledtrial
_version_	1718397392509730816

Effect of the Casein-Derived Peptide Met-Lys-Pro on Cognitive Function in Community-Dwelling Adults Without Dementia: A Randomized, Double-Blind, Placebo-Controlled Trial

Ejemplares similares