Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models

Bone marrow derived-mesenchymal stem cells (BMSCs)-based therapy is an outstanding candidate for cutaneous wound healing. Melatonin (MEL) has been reported for its anti-inflammatory as well as tissue regenerative properties. Existing work aimed to explore the potential healing power of BMSCs pre-tre...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Aljohra M. Al-Otaibi, Asma S. Al-Gebaly, Rafa Almeer, Gadah Albasher, Wedad S. Al-Qahtani, Ahmed E. Abdel Moneim
Formato:	article
Lenguaje:	EN
Publicado:	Elsevier 2022
Materias:	Bone marrow derived-mesenchymal stem cells Melatonin Wound healing VEGF TGF-β NF-κB Therapeutics. Pharmacology RM1-950
Acceso en línea:	https://doaj.org/article/023daae7e3b54d08bf454c6602926454
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:023daae7e3b54d08bf454c6602926454
record_format	dspace
spelling	oai:doaj.org-article:023daae7e3b54d08bf454c66029264542021-12-02T04:59:07ZMelatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models0753-332210.1016/j.biopha.2021.112473https://doaj.org/article/023daae7e3b54d08bf454c66029264542022-01-01T00:00:00Zhttp://www.sciencedirect.com/science/article/pii/S0753332221012592https://doaj.org/toc/0753-3322Bone marrow derived-mesenchymal stem cells (BMSCs)-based therapy is an outstanding candidate for cutaneous wound healing. Melatonin (MEL) has been reported for its anti-inflammatory as well as tissue regenerative properties. Existing work aimed to explore the potential healing power of BMSCs pre-treated with MEL in a skin wound model. Adult rats were allocated into control, PIO, BMSCs (1 × 105 cells), and MEL/BMSCs groups. On the 21 days post-wounding, tissues were sampled for analysis. The results demonstrated that compared to the control group, MEL/BMSCs therapy induced noticeable decline in wound area and elevated rate of wound retraction. Furthermore, marked increases in tissue hydroxyproline, as well as tissue content and gene expression level of vascular endothelial growth factor in MEL/BMSCs treated-wounded animals. Compared to the untreated control group, marked increases were found in antioxidant enzymatic activities together with elevated GSH levels in wounded tissues after MEL/BMSCs treatment. Moreover, therapeutically handled wounds with MEL/BMSCs revealed low levels of MDA, NO and protein carbonyls. Combined therapy with MEL/BMSCs relieved the inflammation witnessed by decreasing IL-1β, TNF-α and NF-κB levels in wounded tissues. Furthermore, noteworthy rises in levels of TGF-β and gene expression of α-SMA were noticed after MEL/BMSCs application that reveals their anti-scarring properties. Histologically, noticeable improvement in histopathological skin lesions in wound area and elevated the collagen synthesis and deposition. Collectively, the obtained data depict that the pre-treatment of BMSCs with MEL could potentially be a successful strategy for scaling-up the wound healing outcomes more than using BMSCs monotherapy in rat models.Aljohra M. Al-OtaibiAsma S. Al-GebalyRafa AlmeerGadah AlbasherWedad S. Al-QahtaniAhmed E. Abdel MoneimElsevierarticleBone marrow derived-mesenchymal stem cellsMelatoninWound healingVEGFTGF-βNF-κBTherapeutics. PharmacologyRM1-950ENBiomedicine & Pharmacotherapy, Vol 145, Iss , Pp 112473- (2022)
institution	DOAJ
collection	DOAJ
language	EN
topic	Bone marrow derived-mesenchymal stem cells Melatonin Wound healing VEGF TGF-β NF-κB Therapeutics. Pharmacology RM1-950
spellingShingle	Bone marrow derived-mesenchymal stem cells Melatonin Wound healing VEGF TGF-β NF-κB Therapeutics. Pharmacology RM1-950 Aljohra M. Al-Otaibi Asma S. Al-Gebaly Rafa Almeer Gadah Albasher Wedad S. Al-Qahtani Ahmed E. Abdel Moneim Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
description	Bone marrow derived-mesenchymal stem cells (BMSCs)-based therapy is an outstanding candidate for cutaneous wound healing. Melatonin (MEL) has been reported for its anti-inflammatory as well as tissue regenerative properties. Existing work aimed to explore the potential healing power of BMSCs pre-treated with MEL in a skin wound model. Adult rats were allocated into control, PIO, BMSCs (1 × 105 cells), and MEL/BMSCs groups. On the 21 days post-wounding, tissues were sampled for analysis. The results demonstrated that compared to the control group, MEL/BMSCs therapy induced noticeable decline in wound area and elevated rate of wound retraction. Furthermore, marked increases in tissue hydroxyproline, as well as tissue content and gene expression level of vascular endothelial growth factor in MEL/BMSCs treated-wounded animals. Compared to the untreated control group, marked increases were found in antioxidant enzymatic activities together with elevated GSH levels in wounded tissues after MEL/BMSCs treatment. Moreover, therapeutically handled wounds with MEL/BMSCs revealed low levels of MDA, NO and protein carbonyls. Combined therapy with MEL/BMSCs relieved the inflammation witnessed by decreasing IL-1β, TNF-α and NF-κB levels in wounded tissues. Furthermore, noteworthy rises in levels of TGF-β and gene expression of α-SMA were noticed after MEL/BMSCs application that reveals their anti-scarring properties. Histologically, noticeable improvement in histopathological skin lesions in wound area and elevated the collagen synthesis and deposition. Collectively, the obtained data depict that the pre-treatment of BMSCs with MEL could potentially be a successful strategy for scaling-up the wound healing outcomes more than using BMSCs monotherapy in rat models.
format	article
author	Aljohra M. Al-Otaibi Asma S. Al-Gebaly Rafa Almeer Gadah Albasher Wedad S. Al-Qahtani Ahmed E. Abdel Moneim
author_facet	Aljohra M. Al-Otaibi Asma S. Al-Gebaly Rafa Almeer Gadah Albasher Wedad S. Al-Qahtani Ahmed E. Abdel Moneim
author_sort	Aljohra M. Al-Otaibi
title	Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
title_short	Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
title_full	Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
title_fullStr	Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
title_full_unstemmed	Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
title_sort	melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models
publisher	Elsevier
publishDate	2022
url	https://doaj.org/article/023daae7e3b54d08bf454c6602926454
work_keys_str_mv	AT aljohramalotaibi melatoninpretreatedbonemarrowderivedmesenchymalstemcellspromptwoundhealinginratmodels AT asmasalgebaly melatoninpretreatedbonemarrowderivedmesenchymalstemcellspromptwoundhealinginratmodels AT rafaalmeer melatoninpretreatedbonemarrowderivedmesenchymalstemcellspromptwoundhealinginratmodels AT gadahalbasher melatoninpretreatedbonemarrowderivedmesenchymalstemcellspromptwoundhealinginratmodels AT wedadsalqahtani melatoninpretreatedbonemarrowderivedmesenchymalstemcellspromptwoundhealinginratmodels AT ahmedeabdelmoneim melatoninpretreatedbonemarrowderivedmesenchymalstemcellspromptwoundhealinginratmodels
_version_	1718400869613961216

Melatonin pre-treated bone marrow derived-mesenchymal stem cells prompt wound healing in rat models

Ejemplares similares