Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.

<h4>Background</h4>Expansins are proteins that loosen plant cell walls in a pH-dependent manner, probably by increasing the relative movement among polymers thus causing irreversible expansion. The expansin superfamily (EXP) comprises four distinct families: expansin A (EXPA), expansin B...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Silvia Dal Santo, Alessandro Vannozzi, Giovanni Battista Tornielli, Marianna Fasoli, Luca Venturini, Mario Pezzotti, Sara Zenoni
Formato:	article
Lenguaje:	EN
Publicado:	Public Library of Science (PLoS) 2013
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/07cfecf6d3214560b5218970f8e82e64
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:07cfecf6d3214560b5218970f8e82e64
record_format	dspace
spelling	oai:doaj.org-article:07cfecf6d3214560b5218970f8e82e642021-11-18T07:49:11ZGenome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.1932-620310.1371/journal.pone.0062206https://doaj.org/article/07cfecf6d3214560b5218970f8e82e642013-01-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/pmid/23614035/pdf/?tool=EBIhttps://doaj.org/toc/1932-6203<h4>Background</h4>Expansins are proteins that loosen plant cell walls in a pH-dependent manner, probably by increasing the relative movement among polymers thus causing irreversible expansion. The expansin superfamily (EXP) comprises four distinct families: expansin A (EXPA), expansin B (EXPB), expansin-like A (EXLA) and expansin-like B (EXLB). There is experimental evidence that EXPA and EXPB proteins are required for cell expansion and developmental processes involving cell wall modification, whereas the exact functions of EXLA and EXLB remain unclear. The complete grapevine (Vitis vinifera) genome sequence has allowed the characterization of many gene families, but an exhaustive genome-wide analysis of expansin gene expression has not been attempted thus far.<h4>Methodology/principal findings</h4>We identified 29 EXP superfamily genes in the grapevine genome, representing all four EXP families. Members of the same EXP family shared the same exon-intron structure, and phylogenetic analysis confirmed a closer relationship between EXP genes from woody species, i.e. grapevine and poplar (Populus trichocarpa), compared to those from Arabidopsis thaliana and rice (Oryza sativa). We also identified grapevine-specific duplication events involving the EXLB family. Global gene expression analysis confirmed a strong correlation among EXP genes expressed in mature and green/vegetative samples, respectively, as reported for other gene families in the recently-published grapevine gene expression atlas. We also observed the specific co-expression of EXLB genes in woody organs, and the involvement of certain grapevine EXP genes in berry development and post-harvest withering.<h4>Conclusion</h4>Our comprehensive analysis of the grapevine EXP superfamily confirmed and extended current knowledge about the structural and functional characteristics of this gene family, and also identified properties that are currently unique to grapevine expansin genes. Our data provide a model for the functional characterization of grapevine gene families by combining phylogenetic analysis with global gene expression profiling.Silvia Dal SantoAlessandro VannozziGiovanni Battista TornielliMarianna FasoliLuca VenturiniMario PezzottiSara ZenoniPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 8, Iss 4, p e62206 (2013)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Silvia Dal Santo Alessandro Vannozzi Giovanni Battista Tornielli Marianna Fasoli Luca Venturini Mario Pezzotti Sara Zenoni Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
description	<h4>Background</h4>Expansins are proteins that loosen plant cell walls in a pH-dependent manner, probably by increasing the relative movement among polymers thus causing irreversible expansion. The expansin superfamily (EXP) comprises four distinct families: expansin A (EXPA), expansin B (EXPB), expansin-like A (EXLA) and expansin-like B (EXLB). There is experimental evidence that EXPA and EXPB proteins are required for cell expansion and developmental processes involving cell wall modification, whereas the exact functions of EXLA and EXLB remain unclear. The complete grapevine (Vitis vinifera) genome sequence has allowed the characterization of many gene families, but an exhaustive genome-wide analysis of expansin gene expression has not been attempted thus far.<h4>Methodology/principal findings</h4>We identified 29 EXP superfamily genes in the grapevine genome, representing all four EXP families. Members of the same EXP family shared the same exon-intron structure, and phylogenetic analysis confirmed a closer relationship between EXP genes from woody species, i.e. grapevine and poplar (Populus trichocarpa), compared to those from Arabidopsis thaliana and rice (Oryza sativa). We also identified grapevine-specific duplication events involving the EXLB family. Global gene expression analysis confirmed a strong correlation among EXP genes expressed in mature and green/vegetative samples, respectively, as reported for other gene families in the recently-published grapevine gene expression atlas. We also observed the specific co-expression of EXLB genes in woody organs, and the involvement of certain grapevine EXP genes in berry development and post-harvest withering.<h4>Conclusion</h4>Our comprehensive analysis of the grapevine EXP superfamily confirmed and extended current knowledge about the structural and functional characteristics of this gene family, and also identified properties that are currently unique to grapevine expansin genes. Our data provide a model for the functional characterization of grapevine gene families by combining phylogenetic analysis with global gene expression profiling.
format	article
author	Silvia Dal Santo Alessandro Vannozzi Giovanni Battista Tornielli Marianna Fasoli Luca Venturini Mario Pezzotti Sara Zenoni
author_facet	Silvia Dal Santo Alessandro Vannozzi Giovanni Battista Tornielli Marianna Fasoli Luca Venturini Mario Pezzotti Sara Zenoni
author_sort	Silvia Dal Santo
title	Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
title_short	Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
title_full	Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
title_fullStr	Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
title_full_unstemmed	Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
title_sort	genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.
publisher	Public Library of Science (PLoS)
publishDate	2013
url	https://doaj.org/article/07cfecf6d3214560b5218970f8e82e64
work_keys_str_mv	AT silviadalsanto genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics AT alessandrovannozzi genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics AT giovannibattistatornielli genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics AT mariannafasoli genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics AT lucaventurini genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics AT mariopezzotti genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics AT sarazenoni genomewideanalysisoftheexpansingenesuperfamilyrevealsgrapevinespecificstructuralandfunctionalcharacteristics
_version_	1718422892013682688

Genome-wide analysis of the expansin gene superfamily reveals grapevine-specific structural and functional characteristics.

Ejemplares similares