Electric pulse characteristics can enable species recognition in African weakly electric fish species

Abstract Communication is key to a wide variety of animal behaviours and multiple modalities are often involved in this exchange of information from sender to receiver. The communication of African weakly electric fish, however, is thought to be predominantly unimodal and is mediated by their electr...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Rebecca Nagel, Frank Kirschbaum, Volker Hofmann, Jacob Engelmann, Ralph Tiedemann
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2018
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/19a02dc7d1ae4bdb8a0953fd7c6d56db
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:19a02dc7d1ae4bdb8a0953fd7c6d56db
record_format	dspace
spelling	oai:doaj.org-article:19a02dc7d1ae4bdb8a0953fd7c6d56db2021-12-02T15:08:36ZElectric pulse characteristics can enable species recognition in African weakly electric fish species10.1038/s41598-018-29132-z2045-2322https://doaj.org/article/19a02dc7d1ae4bdb8a0953fd7c6d56db2018-07-01T00:00:00Zhttps://doi.org/10.1038/s41598-018-29132-zhttps://doaj.org/toc/2045-2322Abstract Communication is key to a wide variety of animal behaviours and multiple modalities are often involved in this exchange of information from sender to receiver. The communication of African weakly electric fish, however, is thought to be predominantly unimodal and is mediated by their electric sense, in which species-specific electric organ discharges (EODs) are generated in a context-dependent and thus variable sequence of pulse intervals (SPI). While the primary function of the electric sense is considered to be electrolocation, both of its components likely carry information regarding identity of the sender. However, a clear understanding of their contribution to species recognition is incomplete. We therefore analysed these two electrocommunication components (EOD waveform and SPI statistics) in two sympatric mormyrid Campylomormyrus species. In a set of five playback conditions, we further investigated which components may drive interspecific recognition and discrimination. While we found that both electrocommunication components are species-specific, the cues necessary for species recognition differ between the two species studied. While the EOD waveform and SPI were both necessary and sufficient for species recognition in C. compressirostris males, C. tamandua males apparently utilize other, non-electric modalities. Mapped onto a recent phylogeny, our results suggest that discrimination by electric cues alone may be an apomorphic trait evolved during a recent radiation in this taxon.Rebecca NagelFrank KirschbaumVolker HofmannJacob EngelmannRalph TiedemannNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 8, Iss 1, Pp 1-12 (2018)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Rebecca Nagel Frank Kirschbaum Volker Hofmann Jacob Engelmann Ralph Tiedemann Electric pulse characteristics can enable species recognition in African weakly electric fish species
description	Abstract Communication is key to a wide variety of animal behaviours and multiple modalities are often involved in this exchange of information from sender to receiver. The communication of African weakly electric fish, however, is thought to be predominantly unimodal and is mediated by their electric sense, in which species-specific electric organ discharges (EODs) are generated in a context-dependent and thus variable sequence of pulse intervals (SPI). While the primary function of the electric sense is considered to be electrolocation, both of its components likely carry information regarding identity of the sender. However, a clear understanding of their contribution to species recognition is incomplete. We therefore analysed these two electrocommunication components (EOD waveform and SPI statistics) in two sympatric mormyrid Campylomormyrus species. In a set of five playback conditions, we further investigated which components may drive interspecific recognition and discrimination. While we found that both electrocommunication components are species-specific, the cues necessary for species recognition differ between the two species studied. While the EOD waveform and SPI were both necessary and sufficient for species recognition in C. compressirostris males, C. tamandua males apparently utilize other, non-electric modalities. Mapped onto a recent phylogeny, our results suggest that discrimination by electric cues alone may be an apomorphic trait evolved during a recent radiation in this taxon.
format	article
author	Rebecca Nagel Frank Kirschbaum Volker Hofmann Jacob Engelmann Ralph Tiedemann
author_facet	Rebecca Nagel Frank Kirschbaum Volker Hofmann Jacob Engelmann Ralph Tiedemann
author_sort	Rebecca Nagel
title	Electric pulse characteristics can enable species recognition in African weakly electric fish species
title_short	Electric pulse characteristics can enable species recognition in African weakly electric fish species
title_full	Electric pulse characteristics can enable species recognition in African weakly electric fish species
title_fullStr	Electric pulse characteristics can enable species recognition in African weakly electric fish species
title_full_unstemmed	Electric pulse characteristics can enable species recognition in African weakly electric fish species
title_sort	electric pulse characteristics can enable species recognition in african weakly electric fish species
publisher	Nature Portfolio
publishDate	2018
url	https://doaj.org/article/19a02dc7d1ae4bdb8a0953fd7c6d56db
work_keys_str_mv	AT rebeccanagel electricpulsecharacteristicscanenablespeciesrecognitioninafricanweaklyelectricfishspecies AT frankkirschbaum electricpulsecharacteristicscanenablespeciesrecognitioninafricanweaklyelectricfishspecies AT volkerhofmann electricpulsecharacteristicscanenablespeciesrecognitioninafricanweaklyelectricfishspecies AT jacobengelmann electricpulsecharacteristicscanenablespeciesrecognitioninafricanweaklyelectricfishspecies AT ralphtiedemann electricpulsecharacteristicscanenablespeciesrecognitioninafricanweaklyelectricfishspecies
_version_	1718388045418332160

Electric pulse characteristics can enable species recognition in African weakly electric fish species

Ejemplares similares