Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma

Lukas Reznicek,* Florian Seidensticker,* Thomas Mann, Irene Hübert, Alexandra Buerger, Christos Haritoglou, Aljoscha S Neubauer, Anselm Kampik, Christoph Hirneiss, Marcus Kernt Department of Ophthalmology, Ludwig-Maximilians-University, Munich, Germany *These authors contributed equally to...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Reznicek L, Seidensticker F, Mann T, H&uuml;bert I, Buerger A, Haritoglou C, Neubauer AS, Kampik A, Hirneiss C, Kernt M
Formato:	article
Lenguaje:	EN
Publicado:	Dove Medical Press 2013
Materias:	Ophthalmology RE1-994
Acceso en línea:	https://doaj.org/article/1e6637fe57124f388b223d2d2e357ed6
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:1e6637fe57124f388b223d2d2e357ed6
record_format	dspace
spelling	oai:doaj.org-article:1e6637fe57124f388b223d2d2e357ed62021-12-02T06:50:40ZCorrelation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma1177-54671177-5483https://doaj.org/article/1e6637fe57124f388b223d2d2e357ed62013-09-01T00:00:00Zhttp://www.dovepress.com/correlation-between-peripapillary-retinal-nerve-fiber-layer-thickness--a14402https://doaj.org/toc/1177-5467https://doaj.org/toc/1177-5483Lukas Reznicek,* Florian Seidensticker,* Thomas Mann, Irene Hübert, Alexandra Buerger, Christos Haritoglou, Aljoscha S Neubauer, Anselm Kampik, Christoph Hirneiss, Marcus Kernt Department of Ophthalmology, Ludwig-Maximilians-University, Munich, Germany *These authors contributed equally to this work Purpose: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. Methods: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advanced glaucomatous visual field defects were included in this study. All study participants underwent a full ophthalmic examination followed by visual field testing with standard automated perimetry as well as spectral-domain optical coherence tomography (SD-OCT) for peripapillary RNFL thickness and Optos wide-field fundus autofluorescence (FAF) images. A pattern grid with corresponding locations between functional visual field sectors and structural peripapillary RNFL thickness was aligned to the FAF images at corresponding location. Mean FAF intensity (range: 0 = black and 255 = white) of each evaluated sector (superotemporal, temporal, inferotemporal, inferonasal, nasal, superonasal) was correlated with the corresponding peripapillary RNFL thickness obtained with SD-OCT. Results: Correlation analyses between sectoral RNFL thickness and standardized FAF intensity in the corresponding topographic retina segments revealed partly significant correlations with correlation coefficients ranging between 0.004 and 0.376 and were statistically significant in the temporal inferior central field (r = 0.324, P = 0.036) and the nasal field (r = 0.376, P = 0.014). Conclusion: Retinal pigment epithelium abnormalities correlate with corresponding peripapillary RNFL damage, especially in the temporal inferior sector of patients with advanced glaucomatous visual field defects. A further evaluation of FAF as a potential predictive parameter for glaucomatous damage is necessary. Keywords: glaucoma, fundus autofluorescence, FAF, retinal nerve fiber layer, RNFL, optical coherence tomography, OCT, imagingReznicek LSeidensticker FMann TH&uuml;bert IBuerger AHaritoglou CNeubauer ASKampik AHirneiss CKernt MDove Medical PressarticleOphthalmologyRE1-994ENClinical Ophthalmology, Vol 2013, Iss default, Pp 1883-1888 (2013)
institution	DOAJ
collection	DOAJ
language	EN
topic	Ophthalmology RE1-994
spellingShingle	Ophthalmology RE1-994 Reznicek L Seidensticker F Mann T H&uuml;bert I Buerger A Haritoglou C Neubauer AS Kampik A Hirneiss C Kernt M Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
description	Lukas Reznicek,* Florian Seidensticker,* Thomas Mann, Irene Hübert, Alexandra Buerger, Christos Haritoglou, Aljoscha S Neubauer, Anselm Kampik, Christoph Hirneiss, Marcus Kernt Department of Ophthalmology, Ludwig-Maximilians-University, Munich, Germany *These authors contributed equally to this work Purpose: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. Methods: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advanced glaucomatous visual field defects were included in this study. All study participants underwent a full ophthalmic examination followed by visual field testing with standard automated perimetry as well as spectral-domain optical coherence tomography (SD-OCT) for peripapillary RNFL thickness and Optos wide-field fundus autofluorescence (FAF) images. A pattern grid with corresponding locations between functional visual field sectors and structural peripapillary RNFL thickness was aligned to the FAF images at corresponding location. Mean FAF intensity (range: 0 = black and 255 = white) of each evaluated sector (superotemporal, temporal, inferotemporal, inferonasal, nasal, superonasal) was correlated with the corresponding peripapillary RNFL thickness obtained with SD-OCT. Results: Correlation analyses between sectoral RNFL thickness and standardized FAF intensity in the corresponding topographic retina segments revealed partly significant correlations with correlation coefficients ranging between 0.004 and 0.376 and were statistically significant in the temporal inferior central field (r = 0.324, P = 0.036) and the nasal field (r = 0.376, P = 0.014). Conclusion: Retinal pigment epithelium abnormalities correlate with corresponding peripapillary RNFL damage, especially in the temporal inferior sector of patients with advanced glaucomatous visual field defects. A further evaluation of FAF as a potential predictive parameter for glaucomatous damage is necessary. Keywords: glaucoma, fundus autofluorescence, FAF, retinal nerve fiber layer, RNFL, optical coherence tomography, OCT, imaging
format	article
author	Reznicek L Seidensticker F Mann T H&uuml;bert I Buerger A Haritoglou C Neubauer AS Kampik A Hirneiss C Kernt M
author_facet	Reznicek L Seidensticker F Mann T H&uuml;bert I Buerger A Haritoglou C Neubauer AS Kampik A Hirneiss C Kernt M
author_sort	Reznicek L
title	Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_short	Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_full	Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_fullStr	Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_full_unstemmed	Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_sort	correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
publisher	Dove Medical Press
publishDate	2013
url	https://doaj.org/article/1e6637fe57124f388b223d2d2e357ed6
work_keys_str_mv	AT reznicekl correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT seidenstickerf correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT mannt correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT hampuumlberti correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT buergera correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT haritoglouc correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT neubaueras correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT kampika correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT hirneissc correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT kerntm correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
_version_	1718399676584034304

Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma

Ejemplares similares