Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells
Abstract Loss of primary cilia in cells deficient for the tumor suppressor von Hippel Lindau (VHL) arise from elevated Aurora Kinase A (AURKA) levels. VHL in its role as an E3 ubiquitin ligase targets AURKA for degradation and in the absence of VHL, high levels of AURKA result in destabilization of...
Guardado en:
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Nature Portfolio
2021
|
Materias: | |
Acceso en línea: | https://doaj.org/article/2ca73e95c5024ae6a9c8ae5e0e85611a |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:2ca73e95c5024ae6a9c8ae5e0e85611a |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:2ca73e95c5024ae6a9c8ae5e0e85611a2021-12-02T15:45:21ZTherapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells10.1038/s41598-021-89933-72045-2322https://doaj.org/article/2ca73e95c5024ae6a9c8ae5e0e85611a2021-05-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-89933-7https://doaj.org/toc/2045-2322Abstract Loss of primary cilia in cells deficient for the tumor suppressor von Hippel Lindau (VHL) arise from elevated Aurora Kinase A (AURKA) levels. VHL in its role as an E3 ubiquitin ligase targets AURKA for degradation and in the absence of VHL, high levels of AURKA result in destabilization of the primary cilium. We identified NVP-BEZ235, a dual PI3K/AKT and mTOR inhibitor, in an image-based high throughput screen, as a small molecule that restored primary cilia in VHL-deficient cells. We identified the ability of AKT to modulate AURKA expression at the transcript and protein level. Independent modulation of AKT and mTOR signaling decreased AURKA expression in cells confirming AURKA as a new signaling node downstream of the PI3K cascade. Corroborating these data, a genetic knockdown of AKT in cells deficient for VHL rescued the ability of these cells to ciliate. Finally, inhibition of AKT/mTOR using NVP-BEZ235 was efficacious in reducing tumor burden in a 786-0 xenograft model of renal cell carcinoma. These data highlight a previously unappreciated signaling node downstream of the AKT/mTOR pathway via AURKA that can be targeted in VHL-null cells to restore ciliogenesis.Pratim ChowdhuryDimuthu PereraReid T. PowellTia TalleyDurga Nand TripathiYong Sung ParkMichael A. ManciniPeter DaviesClifford StephanCristian CorfaRuhee DereNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-13 (2021) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Pratim Chowdhury Dimuthu Perera Reid T. Powell Tia Talley Durga Nand Tripathi Yong Sung Park Michael A. Mancini Peter Davies Clifford Stephan Cristian Corfa Ruhee Dere Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells |
description |
Abstract Loss of primary cilia in cells deficient for the tumor suppressor von Hippel Lindau (VHL) arise from elevated Aurora Kinase A (AURKA) levels. VHL in its role as an E3 ubiquitin ligase targets AURKA for degradation and in the absence of VHL, high levels of AURKA result in destabilization of the primary cilium. We identified NVP-BEZ235, a dual PI3K/AKT and mTOR inhibitor, in an image-based high throughput screen, as a small molecule that restored primary cilia in VHL-deficient cells. We identified the ability of AKT to modulate AURKA expression at the transcript and protein level. Independent modulation of AKT and mTOR signaling decreased AURKA expression in cells confirming AURKA as a new signaling node downstream of the PI3K cascade. Corroborating these data, a genetic knockdown of AKT in cells deficient for VHL rescued the ability of these cells to ciliate. Finally, inhibition of AKT/mTOR using NVP-BEZ235 was efficacious in reducing tumor burden in a 786-0 xenograft model of renal cell carcinoma. These data highlight a previously unappreciated signaling node downstream of the AKT/mTOR pathway via AURKA that can be targeted in VHL-null cells to restore ciliogenesis. |
format |
article |
author |
Pratim Chowdhury Dimuthu Perera Reid T. Powell Tia Talley Durga Nand Tripathi Yong Sung Park Michael A. Mancini Peter Davies Clifford Stephan Cristian Corfa Ruhee Dere |
author_facet |
Pratim Chowdhury Dimuthu Perera Reid T. Powell Tia Talley Durga Nand Tripathi Yong Sung Park Michael A. Mancini Peter Davies Clifford Stephan Cristian Corfa Ruhee Dere |
author_sort |
Pratim Chowdhury |
title |
Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells |
title_short |
Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells |
title_full |
Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells |
title_fullStr |
Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells |
title_full_unstemmed |
Therapeutically actionable signaling node to rescue AURKA driven loss of primary cilia in VHL-deficient cells |
title_sort |
therapeutically actionable signaling node to rescue aurka driven loss of primary cilia in vhl-deficient cells |
publisher |
Nature Portfolio |
publishDate |
2021 |
url |
https://doaj.org/article/2ca73e95c5024ae6a9c8ae5e0e85611a |
work_keys_str_mv |
AT pratimchowdhury therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT dimuthuperera therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT reidtpowell therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT tiatalley therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT durganandtripathi therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT yongsungpark therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT michaelamancini therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT peterdavies therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT cliffordstephan therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT cristiancorfa therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells AT ruheedere therapeuticallyactionablesignalingnodetorescueaurkadrivenlossofprimaryciliainvhldeficientcells |
_version_ |
1718385738472488960 |