Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene

Abstract The thermodynamic properties of few-layer graphene arbitrarily stacked on LiNbO3 crystal were characterized by measuring the parameters of a surface acoustic wave as it passed through the graphene/LiNbO3 interface. The parameters considered included the propagation velocity, frequency, and...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Yong Sun, Kenta Kirimoto, Tsuyoshi Takase, Daichi Eto, Shohei Yoshimura, Shota Tsuru
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/2e6b96ffec2a43a4b685b3c842e2053b
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:2e6b96ffec2a43a4b685b3c842e2053b
record_format	dspace
spelling	oai:doaj.org-article:2e6b96ffec2a43a4b685b3c842e2053b2021-12-05T12:15:16ZPossible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene10.1038/s41598-021-02995-52045-2322https://doaj.org/article/2e6b96ffec2a43a4b685b3c842e2053b2021-12-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-02995-5https://doaj.org/toc/2045-2322Abstract The thermodynamic properties of few-layer graphene arbitrarily stacked on LiNbO3 crystal were characterized by measuring the parameters of a surface acoustic wave as it passed through the graphene/LiNbO3 interface. The parameters considered included the propagation velocity, frequency, and attenuation. Mono-, bi-, tri-, tetra-, and penta-layer graphene samples were prepared by transferring individual graphene layers onto LiNbO3 crystal surfaces at room temperature. Intra-layer lattice deformation was observed in all five samples. Further inter-layer lattice deformation was confirmed in samples with odd numbers of layers. The inter-layer lattice deformation caused stick–slip friction at the graphene/LiNbO3 interface near the temperature at which the layers were stacked. The thermal expansion coefficient of the deformed few-layer graphene transitioned from positive to negative as the number of layers increased. To explain the experimental results, we proposed a few-layer graphene even–odd layer number stacking order effect. A stable pair-graphene structure formed preferentially in the few-layer graphene. In even-layer graphene, the pair-graphene structure formed directly on the LiNbO3 substrate. Contrasting phenomena were noted with odd-layer graphene. Single-layer graphene was bound to the substrate after the stable pair-graphene structure was formed. The pair-graphene structure affected the stacking order and inter-layer lattice deformation of few-layer graphene substantially.Yong SunKenta KirimotoTsuyoshi TakaseDaichi EtoShohei YoshimuraShota TsuruNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-12 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Yong Sun Kenta Kirimoto Tsuyoshi Takase Daichi Eto Shohei Yoshimura Shota Tsuru Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
description	Abstract The thermodynamic properties of few-layer graphene arbitrarily stacked on LiNbO3 crystal were characterized by measuring the parameters of a surface acoustic wave as it passed through the graphene/LiNbO3 interface. The parameters considered included the propagation velocity, frequency, and attenuation. Mono-, bi-, tri-, tetra-, and penta-layer graphene samples were prepared by transferring individual graphene layers onto LiNbO3 crystal surfaces at room temperature. Intra-layer lattice deformation was observed in all five samples. Further inter-layer lattice deformation was confirmed in samples with odd numbers of layers. The inter-layer lattice deformation caused stick–slip friction at the graphene/LiNbO3 interface near the temperature at which the layers were stacked. The thermal expansion coefficient of the deformed few-layer graphene transitioned from positive to negative as the number of layers increased. To explain the experimental results, we proposed a few-layer graphene even–odd layer number stacking order effect. A stable pair-graphene structure formed preferentially in the few-layer graphene. In even-layer graphene, the pair-graphene structure formed directly on the LiNbO3 substrate. Contrasting phenomena were noted with odd-layer graphene. Single-layer graphene was bound to the substrate after the stable pair-graphene structure was formed. The pair-graphene structure affected the stacking order and inter-layer lattice deformation of few-layer graphene substantially.
format	article
author	Yong Sun Kenta Kirimoto Tsuyoshi Takase Daichi Eto Shohei Yoshimura Shota Tsuru
author_facet	Yong Sun Kenta Kirimoto Tsuyoshi Takase Daichi Eto Shohei Yoshimura Shota Tsuru
author_sort	Yong Sun
title	Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
title_short	Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
title_full	Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
title_fullStr	Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
title_full_unstemmed	Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
title_sort	possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/2e6b96ffec2a43a4b685b3c842e2053b
work_keys_str_mv	AT yongsun possiblepairgraphenestructuresgovernthethermodynamicpropertiesofarbitrarilystackedfewlayergraphene AT kentakirimoto possiblepairgraphenestructuresgovernthethermodynamicpropertiesofarbitrarilystackedfewlayergraphene AT tsuyoshitakase possiblepairgraphenestructuresgovernthethermodynamicpropertiesofarbitrarilystackedfewlayergraphene AT daichieto possiblepairgraphenestructuresgovernthethermodynamicpropertiesofarbitrarilystackedfewlayergraphene AT shoheiyoshimura possiblepairgraphenestructuresgovernthethermodynamicpropertiesofarbitrarilystackedfewlayergraphene AT shotatsuru possiblepairgraphenestructuresgovernthethermodynamicpropertiesofarbitrarilystackedfewlayergraphene
_version_	1718372123906408448

Possible pair-graphene structures govern the thermodynamic properties of arbitrarily stacked few-layer graphene

Ejemplares similares