Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review

Ruo-xi Liao, Miao Yu, Yan Jiang, Weibo XiaDepartment of Endocrinology, Key Laboratory of Endocrinology, Ministry of Health, Peking Union Medical College Hospital, and Chinese Academy of Medical Sciences, Beijing, People's Republic of ChinaAbstract: Osteoporosis, a skeletal disorder character...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Liao RX, Yu M, Jiang Y, Xia WB
Formato:	article
Lenguaje:	EN
Publicado:	Dove Medical Press 2014
Materias:	osteoporosis vitamin D calcitriol vitamin D receptor review Geriatrics RC952-954.6
Acceso en línea:	https://doaj.org/article/43564a95cbc0434590152e54e5c2246e
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:43564a95cbc0434590152e54e5c2246e
record_format	dspace
spelling	oai:doaj.org-article:43564a95cbc0434590152e54e5c2246e2021-12-02T02:16:24ZManagement of osteoporosis with calcitriol in elderly Chinese patients: a systematic review1178-1998https://doaj.org/article/43564a95cbc0434590152e54e5c2246e2014-03-01T00:00:00Zhttps://www.dovepress.com/management-of-osteoporosis-with-calcitriol-in-elderly-chinese-patients-peer-reviewed-article-CIAhttps://doaj.org/toc/1178-1998Ruo-xi Liao, Miao Yu, Yan Jiang, Weibo XiaDepartment of Endocrinology, Key Laboratory of Endocrinology, Ministry of Health, Peking Union Medical College Hospital, and Chinese Academy of Medical Sciences, Beijing, People's Republic of ChinaAbstract: Osteoporosis, a skeletal disorder characterized by a reduction in bone strength, is becoming a major public health problem in the People's Republic of China, with a rapid increase observed among the population. Chinese guidelines particularly recommend use of active vitamin D in managing osteoporosis. 1,25-(OH)2D3 (calcitriol) is an active vitamin D metabolite. It plays a role in many biological processes, especially in bone metabolism and muscle function, and is mediated by vitamin D receptors. Osteoporosis in elderly men and women is characterized by uncoupled bone remodeling, which is induced by sex hormone deficiencies, somatopause, vitamin D deficiency, reduced synthesis of D hormone, and lack of receptors or receptor affinity for D hormone in target organs. Reviewed here are six randomized controlled trials on calcitriol monotherapy and five on calcitriol therapy combined with other antiosteoporotic agents. Evidence from these trials shows that calcitriol monotherapy can improve bone mineral density in elderly osteoporotic Chinese patients but may be insufficient for long-term treatment. Calcitriol can also decrease bone turnover markers and bring about significant improvements in muscle strength. Further, calcitriol in combination with other therapeutic bone agents was shown to be well tolerated and capable of additional bone-preserving effects compared with use of calcitriol alone in areas including bone mineral density, bone turnover markers, bone pain improvement, and fracture incidence. Hypercalcemia and hypercalciuria, the most common side effects of calcitriol therapy, were not documented in the trials reviewed, and might have been the result of the low dosages used. One study showed that treatment with calcitriol can improve quality of life in patients with osteoporosis, although not to the same extent as bisphosphonates.Keywords: osteoporosis, vitamin D, calcitriol, vitamin D receptor, reviewLiao RXYu MJiang YXia WBDove Medical Pressarticleosteoporosisvitamin Dcalcitriolvitamin D receptorreviewGeriatricsRC952-954.6ENClinical Interventions in Aging, Vol Volume 9, Pp 515-526 (2014)
institution	DOAJ
collection	DOAJ
language	EN
topic	osteoporosis vitamin D calcitriol vitamin D receptor review Geriatrics RC952-954.6
spellingShingle	osteoporosis vitamin D calcitriol vitamin D receptor review Geriatrics RC952-954.6 Liao RX Yu M Jiang Y Xia WB Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review
description	Ruo-xi Liao, Miao Yu, Yan Jiang, Weibo XiaDepartment of Endocrinology, Key Laboratory of Endocrinology, Ministry of Health, Peking Union Medical College Hospital, and Chinese Academy of Medical Sciences, Beijing, People's Republic of ChinaAbstract: Osteoporosis, a skeletal disorder characterized by a reduction in bone strength, is becoming a major public health problem in the People's Republic of China, with a rapid increase observed among the population. Chinese guidelines particularly recommend use of active vitamin D in managing osteoporosis. 1,25-(OH)2D3 (calcitriol) is an active vitamin D metabolite. It plays a role in many biological processes, especially in bone metabolism and muscle function, and is mediated by vitamin D receptors. Osteoporosis in elderly men and women is characterized by uncoupled bone remodeling, which is induced by sex hormone deficiencies, somatopause, vitamin D deficiency, reduced synthesis of D hormone, and lack of receptors or receptor affinity for D hormone in target organs. Reviewed here are six randomized controlled trials on calcitriol monotherapy and five on calcitriol therapy combined with other antiosteoporotic agents. Evidence from these trials shows that calcitriol monotherapy can improve bone mineral density in elderly osteoporotic Chinese patients but may be insufficient for long-term treatment. Calcitriol can also decrease bone turnover markers and bring about significant improvements in muscle strength. Further, calcitriol in combination with other therapeutic bone agents was shown to be well tolerated and capable of additional bone-preserving effects compared with use of calcitriol alone in areas including bone mineral density, bone turnover markers, bone pain improvement, and fracture incidence. Hypercalcemia and hypercalciuria, the most common side effects of calcitriol therapy, were not documented in the trials reviewed, and might have been the result of the low dosages used. One study showed that treatment with calcitriol can improve quality of life in patients with osteoporosis, although not to the same extent as bisphosphonates.Keywords: osteoporosis, vitamin D, calcitriol, vitamin D receptor, review
format	article
author	Liao RX Yu M Jiang Y Xia WB
author_facet	Liao RX Yu M Jiang Y Xia WB
author_sort	Liao RX
title	Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review
title_short	Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review
title_full	Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review
title_fullStr	Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review
title_full_unstemmed	Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review
title_sort	management of osteoporosis with calcitriol in elderly chinese patients: a systematic review
publisher	Dove Medical Press
publishDate	2014
url	https://doaj.org/article/43564a95cbc0434590152e54e5c2246e
work_keys_str_mv	AT liaorx managementofosteoporosiswithcalcitriolinelderlychinesepatientsasystematicreview AT yum managementofosteoporosiswithcalcitriolinelderlychinesepatientsasystematicreview AT jiangy managementofosteoporosiswithcalcitriolinelderlychinesepatientsasystematicreview AT xiawb managementofosteoporosiswithcalcitriolinelderlychinesepatientsasystematicreview
_version_	1718402589332078592

Management of osteoporosis with calcitriol in elderly Chinese patients: a systematic review

Ejemplares similares