Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients

Abstract Allergic bronchopulmonary aspergillosis (ABPA) is a condition characterized by an exaggerated response of the immune system to the fungus Aspergillus. This study aimed to assess the relationship between carcinoembryonic antigen (CEA) and eosinophils in ABPA patients. We describes a case of...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Yanfei Yang, qiqi Gao, Yangyi Jin, Mengdie Qi, Guohua Lu, HequanLi
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/4ac3947788684011b98afa8b6b14dd53
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:4ac3947788684011b98afa8b6b14dd53
record_format	dspace
spelling	oai:doaj.org-article:4ac3947788684011b98afa8b6b14dd532021-12-02T14:21:50ZEosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients10.1038/s41598-021-83470-z2045-2322https://doaj.org/article/4ac3947788684011b98afa8b6b14dd532021-02-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-83470-zhttps://doaj.org/toc/2045-2322Abstract Allergic bronchopulmonary aspergillosis (ABPA) is a condition characterized by an exaggerated response of the immune system to the fungus Aspergillus. This study aimed to assess the relationship between carcinoembryonic antigen (CEA) and eosinophils in ABPA patients. We describes a case of a 50-year-old patient who was diagnosed with ABPA presenting with high level of CEA and eosinophils. Besides,we used immunohistochemistry and immunofluorescence to identify eosinophils and CEA in sections which were obtained by Endobronchial ultrasound-guided transbronchial lung biopsy aspiration (EBUS-TBLB). The sections were then visualized using confocal microscopy. We also retrospectively analyzed a cohort of 37 ABPA patients between January 2013 and December 2019 in our hospital. We found the patient whose serum CEA levels were consistent with eosinophils during the follow-up (r = 0.929, P = 0.022). The positive expression of CEA and abnormal expression of eosinophils was higher in the ABPA tissue compared to the normal lung tissue. The co-localization was represented as pixels containing both red and green color in the image (with various shades of orange and yellow) which signified that eosinophils were immunohistochemically positive for CEA. Patients with higher levels of eosinophils had higher levels of CEA in the serum (P < 0.001). The results of Pearson correlation analysis showed that the levels of eosinophils were positively correlated with serum CEA levels (r = 0.459 and r = 0.506, P = 0.004 and P = 0.001). Serum CEA level is elevated in ABPA patients. The elevated serum CEA level was shown to be normalized after treatment. Increased CEA levels in ABPA patients may be positively correlated with eosinophil levels, and eosinophils may be served as CEA-secreting cells in patients with ABPA.Yanfei Yangqiqi GaoYangyi JinMengdie QiGuohua LuHequanLiNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-10 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Yanfei Yang qiqi Gao Yangyi Jin Mengdie Qi Guohua Lu HequanLi Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
description	Abstract Allergic bronchopulmonary aspergillosis (ABPA) is a condition characterized by an exaggerated response of the immune system to the fungus Aspergillus. This study aimed to assess the relationship between carcinoembryonic antigen (CEA) and eosinophils in ABPA patients. We describes a case of a 50-year-old patient who was diagnosed with ABPA presenting with high level of CEA and eosinophils. Besides,we used immunohistochemistry and immunofluorescence to identify eosinophils and CEA in sections which were obtained by Endobronchial ultrasound-guided transbronchial lung biopsy aspiration (EBUS-TBLB). The sections were then visualized using confocal microscopy. We also retrospectively analyzed a cohort of 37 ABPA patients between January 2013 and December 2019 in our hospital. We found the patient whose serum CEA levels were consistent with eosinophils during the follow-up (r = 0.929, P = 0.022). The positive expression of CEA and abnormal expression of eosinophils was higher in the ABPA tissue compared to the normal lung tissue. The co-localization was represented as pixels containing both red and green color in the image (with various shades of orange and yellow) which signified that eosinophils were immunohistochemically positive for CEA. Patients with higher levels of eosinophils had higher levels of CEA in the serum (P < 0.001). The results of Pearson correlation analysis showed that the levels of eosinophils were positively correlated with serum CEA levels (r = 0.459 and r = 0.506, P = 0.004 and P = 0.001). Serum CEA level is elevated in ABPA patients. The elevated serum CEA level was shown to be normalized after treatment. Increased CEA levels in ABPA patients may be positively correlated with eosinophil levels, and eosinophils may be served as CEA-secreting cells in patients with ABPA.
format	article
author	Yanfei Yang qiqi Gao Yangyi Jin Mengdie Qi Guohua Lu HequanLi
author_facet	Yanfei Yang qiqi Gao Yangyi Jin Mengdie Qi Guohua Lu HequanLi
author_sort	Yanfei Yang
title	Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_short	Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_full	Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_fullStr	Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_full_unstemmed	Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients
title_sort	eosinophils may serve as cea-secreting cells for allergic bronchopulmonary aspergillosis (abpa) patients
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/4ac3947788684011b98afa8b6b14dd53
work_keys_str_mv	AT yanfeiyang eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients AT qiqigao eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients AT yangyijin eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients AT mengdieqi eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients AT guohualu eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients AT hequanli eosinophilsmayserveasceasecretingcellsforallergicbronchopulmonaryaspergillosisabpapatients
_version_	1718391484510633984

Eosinophils may serve as CEA-secreting cells for allergic bronchopulmonary aspergillosis (ABPA) patients

Ejemplares similares