S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.

<h4>Background and aims</h4>Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein marker...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Lisa Reinhard, Christian Rupp, Hans-Dieter Riedel, Thomas Ruppert, Thomas Giese, Christa Flechtenmacher, Karl Heinz Weiss, Petra Kloeters-Plachky, Wolfgang Stremmel, Peter Schirmacher, Peter Sauer, Daniel Nils Gotthardt
Formato:	article
Lenguaje:	EN
Publicado:	Public Library of Science (PLoS) 2012
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/4c9a56774a794a25ad324c6ba31a69cb
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:4c9a56774a794a25ad324c6ba31a69cb
record_format	dspace
spelling	oai:doaj.org-article:4c9a56774a794a25ad324c6ba31a69cb2021-11-18T07:30:29ZS100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.1932-620310.1371/journal.pone.0029821https://doaj.org/article/4c9a56774a794a25ad324c6ba31a69cb2012-01-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/pmid/22253789/pdf/?tool=EBIhttps://doaj.org/toc/1932-6203<h4>Background and aims</h4>Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach.<h4>Methods</h4>Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR.<h4>Results</h4>A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05).<h4>Conclusions</h4>The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation.Lisa ReinhardChristian RuppHans-Dieter RiedelThomas RuppertThomas GieseChrista FlechtenmacherKarl Heinz WeissPetra Kloeters-PlachkyWolfgang StremmelPeter SchirmacherPeter SauerDaniel Nils GotthardtPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 7, Iss 1, p e29821 (2012)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Lisa Reinhard Christian Rupp Hans-Dieter Riedel Thomas Ruppert Thomas Giese Christa Flechtenmacher Karl Heinz Weiss Petra Kloeters-Plachky Wolfgang Stremmel Peter Schirmacher Peter Sauer Daniel Nils Gotthardt S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
description	<h4>Background and aims</h4>Bile analysis has the potential to serve as a surrogate marker for inflammatory and neoplastic disorders of the biliary epithelium and may provide insight into biliary pathophysiology and possible diagnostic markers. We aimed to identify biliary protein markers of patients with primary sclerosing cholangitis (PSC) by a proteomic approach.<h4>Methods</h4>Bile duct-derived bile samples were collected from PSC patients (n = 45) or patients with choledocholithiasis (n = 24, the control group). Liquid chromatography-tandem mass spectrometry (LC-MS/MS) was performed to analyse the proteins, 2-D-gel patterns were compared by densitometry, and brush cytology specimens were analysed by RT-PCR.<h4>Results</h4>A reference bile-duct bile proteome was established in the control group without signs of inflammation or maligancy comprising a total of 379 non-redundant biliary proteins; 21% were of unknown function and 24% had been previously described in serum. In PSC patients, the biliary S100A9 expression was elevated 95-fold (p<0.005), serum protein expression was decreased, and pancreatic enzyme expression was unchanged compared to controls. The S100A9 expression was 2-fold higher in PSC patients with high disease activity than in those with low activity (p<0.05). The brush cytology specimens from the PSC patients with high disease activity showed marked inflammatory activity and leukocyte infiltration compared to the patients with low activity, which correlated with S100A9 mRNA expression (p<0.05).<h4>Conclusions</h4>The bile-duct bile proteome is complex and its analysis might enhance the understanding of cholestatic liver disease. Biliary S100A9 levels may be a useful marker for PSC activity, and its implication in inflammation and carcinogenesis warrants further investigation.
format	article
author	Lisa Reinhard Christian Rupp Hans-Dieter Riedel Thomas Ruppert Thomas Giese Christa Flechtenmacher Karl Heinz Weiss Petra Kloeters-Plachky Wolfgang Stremmel Peter Schirmacher Peter Sauer Daniel Nils Gotthardt
author_facet	Lisa Reinhard Christian Rupp Hans-Dieter Riedel Thomas Ruppert Thomas Giese Christa Flechtenmacher Karl Heinz Weiss Petra Kloeters-Plachky Wolfgang Stremmel Peter Schirmacher Peter Sauer Daniel Nils Gotthardt
author_sort	Lisa Reinhard
title	S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_short	S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_full	S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_fullStr	S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_full_unstemmed	S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
title_sort	s100a9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.
publisher	Public Library of Science (PLoS)
publishDate	2012
url	https://doaj.org/article/4c9a56774a794a25ad324c6ba31a69cb
work_keys_str_mv	AT lisareinhard s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT christianrupp s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT hansdieterriedel s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT thomasruppert s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT thomasgiese s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT christaflechtenmacher s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT karlheinzweiss s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT petrakloetersplachky s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT wolfgangstremmel s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT peterschirmacher s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT petersauer s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis AT danielnilsgotthardt s100a9isabiliaryproteinmarkerofdiseaseactivityinprimarysclerosingcholangitis
_version_	1718423343414116352

S100A9 is a biliary protein marker of disease activity in primary sclerosing cholangitis.

Ejemplares similares