Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection

Abstract COVID-19 is an infection caused by SARS-CoV-2 (Severe Acute Respiratory Syndrome coronavirus 2), which has caused a global outbreak. Current research efforts are focused on the understanding of the molecular mechanisms involved in SARS-CoV-2 infection in order to propose drug-based therapeu...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Marisol Salgado-Albarrán, Erick I. Navarro-Delgado, Aylin Del Moral-Morales, Nicolas Alcaraz, Jan Baumbach, Rodrigo González-Barrios, Ernesto Soto-Reyes
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Biology (General) QH301-705.5
Acceso en línea:	https://doaj.org/article/4d990f7336bf4aae92344b478e6907e8
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:4d990f7336bf4aae92344b478e6907e8
record_format	dspace
spelling	oai:doaj.org-article:4d990f7336bf4aae92344b478e6907e82021-12-02T15:49:53ZComparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection10.1038/s41540-021-00181-x2056-7189https://doaj.org/article/4d990f7336bf4aae92344b478e6907e82021-05-01T00:00:00Zhttps://doi.org/10.1038/s41540-021-00181-xhttps://doaj.org/toc/2056-7189Abstract COVID-19 is an infection caused by SARS-CoV-2 (Severe Acute Respiratory Syndrome coronavirus 2), which has caused a global outbreak. Current research efforts are focused on the understanding of the molecular mechanisms involved in SARS-CoV-2 infection in order to propose drug-based therapeutic options. Transcriptional changes due to epigenetic regulation are key host cell responses to viral infection and have been studied in SARS-CoV and MERS-CoV; however, such changes are not fully described for SARS-CoV-2. In this study, we analyzed multiple transcriptomes obtained from cell lines infected with MERS-CoV, SARS-CoV, and SARS-CoV-2, and from COVID-19 patient-derived samples. Using integrative analyses of gene co-expression networks and de-novo pathway enrichment, we characterize different gene modules and protein pathways enriched with Transcription Factors or Epifactors relevant for SARS-CoV-2 infection. We identified EP300, MOV10, RELA, and TRIM25 as top candidates, and more than 60 additional proteins involved in the epigenetic response during viral infection that has therapeutic potential. Our results show that targeting the epigenetic machinery could be a feasible alternative to treat COVID-19.Marisol Salgado-AlbarránErick I. Navarro-DelgadoAylin Del Moral-MoralesNicolas AlcarazJan BaumbachRodrigo González-BarriosErnesto Soto-ReyesNature PortfolioarticleBiology (General)QH301-705.5ENnpj Systems Biology and Applications, Vol 7, Iss 1, Pp 1-14 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Biology (General) QH301-705.5
spellingShingle	Biology (General) QH301-705.5 Marisol Salgado-Albarrán Erick I. Navarro-Delgado Aylin Del Moral-Morales Nicolas Alcaraz Jan Baumbach Rodrigo González-Barrios Ernesto Soto-Reyes Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection
description	Abstract COVID-19 is an infection caused by SARS-CoV-2 (Severe Acute Respiratory Syndrome coronavirus 2), which has caused a global outbreak. Current research efforts are focused on the understanding of the molecular mechanisms involved in SARS-CoV-2 infection in order to propose drug-based therapeutic options. Transcriptional changes due to epigenetic regulation are key host cell responses to viral infection and have been studied in SARS-CoV and MERS-CoV; however, such changes are not fully described for SARS-CoV-2. In this study, we analyzed multiple transcriptomes obtained from cell lines infected with MERS-CoV, SARS-CoV, and SARS-CoV-2, and from COVID-19 patient-derived samples. Using integrative analyses of gene co-expression networks and de-novo pathway enrichment, we characterize different gene modules and protein pathways enriched with Transcription Factors or Epifactors relevant for SARS-CoV-2 infection. We identified EP300, MOV10, RELA, and TRIM25 as top candidates, and more than 60 additional proteins involved in the epigenetic response during viral infection that has therapeutic potential. Our results show that targeting the epigenetic machinery could be a feasible alternative to treat COVID-19.
format	article
author	Marisol Salgado-Albarrán Erick I. Navarro-Delgado Aylin Del Moral-Morales Nicolas Alcaraz Jan Baumbach Rodrigo González-Barrios Ernesto Soto-Reyes
author_facet	Marisol Salgado-Albarrán Erick I. Navarro-Delgado Aylin Del Moral-Morales Nicolas Alcaraz Jan Baumbach Rodrigo González-Barrios Ernesto Soto-Reyes
author_sort	Marisol Salgado-Albarrán
title	Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection
title_short	Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection
title_full	Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection
title_fullStr	Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection
title_full_unstemmed	Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection
title_sort	comparative transcriptome analysis reveals key epigenetic targets in sars-cov-2 infection
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/4d990f7336bf4aae92344b478e6907e8
work_keys_str_mv	AT marisolsalgadoalbarran comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection AT erickinavarrodelgado comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection AT aylindelmoralmorales comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection AT nicolasalcaraz comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection AT janbaumbach comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection AT rodrigogonzalezbarrios comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection AT ernestosotoreyes comparativetranscriptomeanalysisrevealskeyepigenetictargetsinsarscov2infection
_version_	1718385688116723712

Comparative transcriptome analysis reveals key epigenetic targets in SARS-CoV-2 infection

Ejemplares similares