Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation

The peripheral membrane proto-oncogene Src family protein tyrosine kinases (SFKs) transmit growth factor signals to the cytoplasm. Here the authors show that the solubilising factor UNC119 sequesters myristoylated SFKs to maintain its enrichment at the plasma membrane to enable signal transduction.

Guardado en:

Detalles Bibliográficos
Autores principales:	Antonios D. Konitsiotis, Lisaweta Roßmannek, Angel Stanoev, Malte Schmick, Philippe I. H. Bastiaens
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2017
Materias:	Science Q
Acceso en línea:	https://doaj.org/article/5820627d5add4bfe8407435d3d729571
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:5820627d5add4bfe8407435d3d729571
record_format	dspace
spelling	oai:doaj.org-article:5820627d5add4bfe8407435d3d7295712021-12-02T13:23:47ZSpatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation10.1038/s41467-017-00116-32041-1723https://doaj.org/article/5820627d5add4bfe8407435d3d7295712017-07-01T00:00:00Zhttps://doi.org/10.1038/s41467-017-00116-3https://doaj.org/toc/2041-1723The peripheral membrane proto-oncogene Src family protein tyrosine kinases (SFKs) transmit growth factor signals to the cytoplasm. Here the authors show that the solubilising factor UNC119 sequesters myristoylated SFKs to maintain its enrichment at the plasma membrane to enable signal transduction.Antonios D. KonitsiotisLisaweta RoßmannekAngel StanoevMalte SchmickPhilippe I. H. BastiaensNature PortfolioarticleScienceQENNature Communications, Vol 8, Iss 1, Pp 1-17 (2017)
institution	DOAJ
collection	DOAJ
language	EN
topic	Science Q
spellingShingle	Science Q Antonios D. Konitsiotis Lisaweta Roßmannek Angel Stanoev Malte Schmick Philippe I. H. Bastiaens Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
description	The peripheral membrane proto-oncogene Src family protein tyrosine kinases (SFKs) transmit growth factor signals to the cytoplasm. Here the authors show that the solubilising factor UNC119 sequesters myristoylated SFKs to maintain its enrichment at the plasma membrane to enable signal transduction.
format	article
author	Antonios D. Konitsiotis Lisaweta Roßmannek Angel Stanoev Malte Schmick Philippe I. H. Bastiaens
author_facet	Antonios D. Konitsiotis Lisaweta Roßmannek Angel Stanoev Malte Schmick Philippe I. H. Bastiaens
author_sort	Antonios D. Konitsiotis
title	Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
title_short	Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
title_full	Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
title_fullStr	Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
title_full_unstemmed	Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation
title_sort	spatial cycles mediated by unc119 solubilisation maintain src family kinases plasma membrane localisation
publisher	Nature Portfolio
publishDate	2017
url	https://doaj.org/article/5820627d5add4bfe8407435d3d729571
work_keys_str_mv	AT antoniosdkonitsiotis spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT lisawetaroßmannek spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT angelstanoev spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT malteschmick spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation AT philippeihbastiaens spatialcyclesmediatedbyunc119solubilisationmaintainsrcfamilykinasesplasmamembranelocalisation
_version_	1718393150298390528

Spatial cycles mediated by UNC119 solubilisation maintain Src family kinases plasma membrane localisation

Ejemplares similares