Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report
Abstract Background Mevalonate kinase deficiency (MKD) is a rare autoinflammatory condition caused by biallelic loss-of-function (LOF) mutations in mevalonate kinase (MVK) gene encoding the enzyme mevalonate kinase. Patients with MKD display a variety of non-specific clinical manifestations, which c...
Guardado en:
Autores principales: | , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
BMC
2021
|
Materias: | |
Acceso en línea: | https://doaj.org/article/6526b0dfe00b45159b766f0e2519ef01 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:6526b0dfe00b45159b766f0e2519ef01 |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:6526b0dfe00b45159b766f0e2519ef012021-11-28T12:04:44ZVasculitis in a patient with mevalonate kinase deficiency (MKD): a case report10.1186/s12969-021-00645-81546-0096https://doaj.org/article/6526b0dfe00b45159b766f0e2519ef012021-11-01T00:00:00Zhttps://doi.org/10.1186/s12969-021-00645-8https://doaj.org/toc/1546-0096Abstract Background Mevalonate kinase deficiency (MKD) is a rare autoinflammatory condition caused by biallelic loss-of-function (LOF) mutations in mevalonate kinase (MVK) gene encoding the enzyme mevalonate kinase. Patients with MKD display a variety of non-specific clinical manifestations, which can lead to diagnostic delay. We report the case of a child presenting with vasculitis that was found by genetic testing to be caused by MKD, and now add this autoinflammatory disease to the ever-expanding list of causes of monogenic vasculitides. Case presentation A 2-year-old male presented with an acute 7-day history of high-grade fever, abdominal pain, diarrhoea, rectal bleeding and extensive purpuric and necrotic lesions, predominantly affecting the lower limbs. He had been suffering from recurrent episodes of fever from early in infancy, associated with maculopapular/petechial rashes triggered by intercurrent infection, and after vaccines. Extensive infection screen was negative. Skin biopsy revealed small vessel vasculitis. Visceral digital subtraction arteriography was normal. With a diagnosis of severe idiopathic cutaneous vasculitis, he was treated with corticosteroids and mycophenolate mofetil. Despite that his acute phase reactants remained elevated, fever persisted and the vasculitic lesions progressed. Next-generation sequencing revealed compound heterozygous mutation in MVK c.928G > A (p.V310M) and c.1129G > A (p.V377I) while reduced mevalonate enzyme activity was confirmed suggesting a diagnosis of MKD as a cause of the severe vasculitis. Prompt targeted treatment with IL-1 blockade was initiated preventing escalation to more toxic vasculitis therapies and reducing unnecessary exposure to cytotoxic treatment. Conclusions Our report highlights the broad clinical phenotype of MKD that includes severe cutaneous vasculitis and emphasizes the need to consider early genetic screening for young children presenting with vasculitis to exclude a monogenic vasculitis which may be amenable to targeted treatment.Ebun OmoyinmiDorota RowczenioNeil SebirePaul A. BroganDespina EleftheriouBMCarticleMevalonate kinase deficiencyAutoinflammationCutaneous vasculitisNext-generation sequencingIL-1 blockadePediatricsRJ1-570Diseases of the musculoskeletal systemRC925-935ENPediatric Rheumatology Online Journal, Vol 19, Iss 1, Pp 1-4 (2021) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Mevalonate kinase deficiency Autoinflammation Cutaneous vasculitis Next-generation sequencing IL-1 blockade Pediatrics RJ1-570 Diseases of the musculoskeletal system RC925-935 |
spellingShingle |
Mevalonate kinase deficiency Autoinflammation Cutaneous vasculitis Next-generation sequencing IL-1 blockade Pediatrics RJ1-570 Diseases of the musculoskeletal system RC925-935 Ebun Omoyinmi Dorota Rowczenio Neil Sebire Paul A. Brogan Despina Eleftheriou Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report |
description |
Abstract Background Mevalonate kinase deficiency (MKD) is a rare autoinflammatory condition caused by biallelic loss-of-function (LOF) mutations in mevalonate kinase (MVK) gene encoding the enzyme mevalonate kinase. Patients with MKD display a variety of non-specific clinical manifestations, which can lead to diagnostic delay. We report the case of a child presenting with vasculitis that was found by genetic testing to be caused by MKD, and now add this autoinflammatory disease to the ever-expanding list of causes of monogenic vasculitides. Case presentation A 2-year-old male presented with an acute 7-day history of high-grade fever, abdominal pain, diarrhoea, rectal bleeding and extensive purpuric and necrotic lesions, predominantly affecting the lower limbs. He had been suffering from recurrent episodes of fever from early in infancy, associated with maculopapular/petechial rashes triggered by intercurrent infection, and after vaccines. Extensive infection screen was negative. Skin biopsy revealed small vessel vasculitis. Visceral digital subtraction arteriography was normal. With a diagnosis of severe idiopathic cutaneous vasculitis, he was treated with corticosteroids and mycophenolate mofetil. Despite that his acute phase reactants remained elevated, fever persisted and the vasculitic lesions progressed. Next-generation sequencing revealed compound heterozygous mutation in MVK c.928G > A (p.V310M) and c.1129G > A (p.V377I) while reduced mevalonate enzyme activity was confirmed suggesting a diagnosis of MKD as a cause of the severe vasculitis. Prompt targeted treatment with IL-1 blockade was initiated preventing escalation to more toxic vasculitis therapies and reducing unnecessary exposure to cytotoxic treatment. Conclusions Our report highlights the broad clinical phenotype of MKD that includes severe cutaneous vasculitis and emphasizes the need to consider early genetic screening for young children presenting with vasculitis to exclude a monogenic vasculitis which may be amenable to targeted treatment. |
format |
article |
author |
Ebun Omoyinmi Dorota Rowczenio Neil Sebire Paul A. Brogan Despina Eleftheriou |
author_facet |
Ebun Omoyinmi Dorota Rowczenio Neil Sebire Paul A. Brogan Despina Eleftheriou |
author_sort |
Ebun Omoyinmi |
title |
Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report |
title_short |
Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report |
title_full |
Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report |
title_fullStr |
Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report |
title_full_unstemmed |
Vasculitis in a patient with mevalonate kinase deficiency (MKD): a case report |
title_sort |
vasculitis in a patient with mevalonate kinase deficiency (mkd): a case report |
publisher |
BMC |
publishDate |
2021 |
url |
https://doaj.org/article/6526b0dfe00b45159b766f0e2519ef01 |
work_keys_str_mv |
AT ebunomoyinmi vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport AT dorotarowczenio vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport AT neilsebire vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport AT paulabrogan vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport AT despinaeleftheriou vasculitisinapatientwithmevalonatekinasedeficiencymkdacasereport |
_version_ |
1718408201732358144 |