Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice

Abstract Protectin DX (PDX), a double lipoxygenase derivative of docosahexaenoic acid, has been reported to attenuate inflammation and insulin resistance. In the current study, we explored the effects of PDX on hyperlipidemia-induced insulin resistance and inflammation through AMP-activated protein...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Tae Woo Jung, Hyoung-Chun Kim, A. M. Abd El-Aty, Ji Hoon Jeong
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2017
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/678163e35f0343a39c37f30aa2077953
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:678163e35f0343a39c37f30aa2077953
record_format	dspace
spelling	oai:doaj.org-article:678163e35f0343a39c37f30aa20779532021-12-02T16:06:31ZProtectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice10.1038/s41598-017-01603-92045-2322https://doaj.org/article/678163e35f0343a39c37f30aa20779532017-05-01T00:00:00Zhttps://doi.org/10.1038/s41598-017-01603-9https://doaj.org/toc/2045-2322Abstract Protectin DX (PDX), a double lipoxygenase derivative of docosahexaenoic acid, has been reported to attenuate inflammation and insulin resistance. In the current study, we explored the effects of PDX on hyperlipidemia-induced insulin resistance and inflammation through AMP-activated protein kinase (AMPK) and peroxisome proliferator-activated receptor α (PPARα). PDX attenuated the impairment of insulin receptor substrate 1/Akt–mediated insulin signaling in palmitate-treated differentiated C2C12 cells and soleus skeletal muscle of HFD-fed mice. Furthermore, PDX treatment significantly ameliorated HFD-induced weight gain and improved glucose tolerance in mice. Nuclear factor kB nuclear translocation, inhibitory kBα phosphorylation, and expression of proinflammatory cytokines were markedly attenuated by PDX in both in vitro and in vivo models. PDX treatment markedly augmented AMPK phosphorylation and PPARα expression in C2C12 cells and in skeletal muscle of mice. AMPK- and PPARα-specific siRNAs significantly abrogated the suppressive effects of PDX on palmitate-induced insulin resistance and inflammation. Furthermore, PDX markedly stimulated the expression of genes related to fatty acid oxidation. These effects of PDX were significantly suppressed by AMPK and PPARα siRNAs. In conclusion, our results demonstrate that PDX ameliorates insulin resistance and inflammation and stimulates fatty acid oxidation through AMPK- and PPARα-mediated pathways in skeletal muscle.Tae Woo JungHyoung-Chun KimA. M. Abd El-AtyJi Hoon JeongNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 7, Iss 1, Pp 1-9 (2017)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Tae Woo Jung Hyoung-Chun Kim A. M. Abd El-Aty Ji Hoon Jeong Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice
description	Abstract Protectin DX (PDX), a double lipoxygenase derivative of docosahexaenoic acid, has been reported to attenuate inflammation and insulin resistance. In the current study, we explored the effects of PDX on hyperlipidemia-induced insulin resistance and inflammation through AMP-activated protein kinase (AMPK) and peroxisome proliferator-activated receptor α (PPARα). PDX attenuated the impairment of insulin receptor substrate 1/Akt–mediated insulin signaling in palmitate-treated differentiated C2C12 cells and soleus skeletal muscle of HFD-fed mice. Furthermore, PDX treatment significantly ameliorated HFD-induced weight gain and improved glucose tolerance in mice. Nuclear factor kB nuclear translocation, inhibitory kBα phosphorylation, and expression of proinflammatory cytokines were markedly attenuated by PDX in both in vitro and in vivo models. PDX treatment markedly augmented AMPK phosphorylation and PPARα expression in C2C12 cells and in skeletal muscle of mice. AMPK- and PPARα-specific siRNAs significantly abrogated the suppressive effects of PDX on palmitate-induced insulin resistance and inflammation. Furthermore, PDX markedly stimulated the expression of genes related to fatty acid oxidation. These effects of PDX were significantly suppressed by AMPK and PPARα siRNAs. In conclusion, our results demonstrate that PDX ameliorates insulin resistance and inflammation and stimulates fatty acid oxidation through AMPK- and PPARα-mediated pathways in skeletal muscle.
format	article
author	Tae Woo Jung Hyoung-Chun Kim A. M. Abd El-Aty Ji Hoon Jeong
author_facet	Tae Woo Jung Hyoung-Chun Kim A. M. Abd El-Aty Ji Hoon Jeong
author_sort	Tae Woo Jung
title	Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice
title_short	Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice
title_full	Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice
title_fullStr	Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice
title_full_unstemmed	Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice
title_sort	protectin dx ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an ampk-pparα-dependent pathway in mice
publisher	Nature Portfolio
publishDate	2017
url	https://doaj.org/article/678163e35f0343a39c37f30aa2077953
work_keys_str_mv	AT taewoojung protectindxamelioratespalmitateorhighfatdietinducedinsulinresistanceandinflammationthroughanampkpparadependentpathwayinmice AT hyoungchunkim protectindxamelioratespalmitateorhighfatdietinducedinsulinresistanceandinflammationthroughanampkpparadependentpathwayinmice AT amabdelaty protectindxamelioratespalmitateorhighfatdietinducedinsulinresistanceandinflammationthroughanampkpparadependentpathwayinmice AT jihoonjeong protectindxamelioratespalmitateorhighfatdietinducedinsulinresistanceandinflammationthroughanampkpparadependentpathwayinmice
_version_	1718384964159930368

Protectin DX ameliorates palmitate- or high-fat diet-induced insulin resistance and inflammation through an AMPK-PPARα-dependent pathway in mice

Ejemplares similares