Single-layer phase gradient mmWave metasurface for incident angle independent focusing

Abstract Metasurfaces allow the rapid development of compact and flat electromagnetic devices owing to their capability in manipulating the wavefront of electromagnetic waves. Particularly, with respect to the metasurface lenses, wide operational bandwidth and wide incident angle behavior are critic...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Wonwoo Lee, Semin Jo, Kanghyeok Lee, Hong Soo Park, Junhyuk Yang, Ha Young Hong, Changkun Park, Sun K. Hong, Hojin Lee
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/67f7a476efe9450c8ee7d675af41a490
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:67f7a476efe9450c8ee7d675af41a490
record_format	dspace
spelling	oai:doaj.org-article:67f7a476efe9450c8ee7d675af41a4902021-12-02T16:04:36ZSingle-layer phase gradient mmWave metasurface for incident angle independent focusing10.1038/s41598-021-92083-52045-2322https://doaj.org/article/67f7a476efe9450c8ee7d675af41a4902021-06-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-92083-5https://doaj.org/toc/2045-2322Abstract Metasurfaces allow the rapid development of compact and flat electromagnetic devices owing to their capability in manipulating the wavefront of electromagnetic waves. Particularly, with respect to the metasurface lenses, wide operational bandwidth and wide incident angle behavior are critically required for practical applications. Herein, a single-layer phase gradient metasurface lens is presented to achieve millimeter-wave focusing at a focal point of 13 mm regardless of the incident angle. The proposed metasurface lens is fabricated by constructing subwavelength-thick (< λ/10) phase elements composed of two metallic layers separated by a single dielectric substrate that exhibits low-Q resonance properties and a wide phase modulation range with satisfactory transmissivity. By controlling the spatial phase distribution, the proposed metasurface lens successfully realises effective wavefront manipulation properties and high-performance electromagnetic-wave-focusing characteristics over a wide operating frequency range from 35 to 40 GHz with incident angle independency up to 30°.Wonwoo LeeSemin JoKanghyeok LeeHong Soo ParkJunhyuk YangHa Young HongChangkun ParkSun K. HongHojin LeeNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-7 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Wonwoo Lee Semin Jo Kanghyeok Lee Hong Soo Park Junhyuk Yang Ha Young Hong Changkun Park Sun K. Hong Hojin Lee Single-layer phase gradient mmWave metasurface for incident angle independent focusing
description	Abstract Metasurfaces allow the rapid development of compact and flat electromagnetic devices owing to their capability in manipulating the wavefront of electromagnetic waves. Particularly, with respect to the metasurface lenses, wide operational bandwidth and wide incident angle behavior are critically required for practical applications. Herein, a single-layer phase gradient metasurface lens is presented to achieve millimeter-wave focusing at a focal point of 13 mm regardless of the incident angle. The proposed metasurface lens is fabricated by constructing subwavelength-thick (< λ/10) phase elements composed of two metallic layers separated by a single dielectric substrate that exhibits low-Q resonance properties and a wide phase modulation range with satisfactory transmissivity. By controlling the spatial phase distribution, the proposed metasurface lens successfully realises effective wavefront manipulation properties and high-performance electromagnetic-wave-focusing characteristics over a wide operating frequency range from 35 to 40 GHz with incident angle independency up to 30°.
format	article
author	Wonwoo Lee Semin Jo Kanghyeok Lee Hong Soo Park Junhyuk Yang Ha Young Hong Changkun Park Sun K. Hong Hojin Lee
author_facet	Wonwoo Lee Semin Jo Kanghyeok Lee Hong Soo Park Junhyuk Yang Ha Young Hong Changkun Park Sun K. Hong Hojin Lee
author_sort	Wonwoo Lee
title	Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_short	Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_full	Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_fullStr	Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_full_unstemmed	Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_sort	single-layer phase gradient mmwave metasurface for incident angle independent focusing
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/67f7a476efe9450c8ee7d675af41a490
work_keys_str_mv	AT wonwoolee singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT seminjo singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT kanghyeoklee singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT hongsoopark singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT junhyukyang singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT hayounghong singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT changkunpark singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT sunkhong singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing AT hojinlee singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
_version_	1718385211167735808

Single-layer phase gradient mmWave metasurface for incident angle independent focusing

Ejemplares similares