Single-layer phase gradient mmWave metasurface for incident angle independent focusing

Abstract Metasurfaces allow the rapid development of compact and flat electromagnetic devices owing to their capability in manipulating the wavefront of electromagnetic waves. Particularly, with respect to the metasurface lenses, wide operational bandwidth and wide incident angle behavior are critic...

Full description

Saved in:
Bibliographic Details
Main Authors: Wonwoo Lee, Semin Jo, Kanghyeok Lee, Hong Soo Park, Junhyuk Yang, Ha Young Hong, Changkun Park, Sun K. Hong, Hojin Lee
Format: article
Language:EN
Published: Nature Portfolio 2021
Subjects:
R
Q
Online Access:https://doaj.org/article/67f7a476efe9450c8ee7d675af41a490
Tags: Add Tag
No Tags, Be the first to tag this record!
id oai:doaj.org-article:67f7a476efe9450c8ee7d675af41a490
record_format dspace
spelling oai:doaj.org-article:67f7a476efe9450c8ee7d675af41a4902021-12-02T16:04:36ZSingle-layer phase gradient mmWave metasurface for incident angle independent focusing10.1038/s41598-021-92083-52045-2322https://doaj.org/article/67f7a476efe9450c8ee7d675af41a4902021-06-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-92083-5https://doaj.org/toc/2045-2322Abstract Metasurfaces allow the rapid development of compact and flat electromagnetic devices owing to their capability in manipulating the wavefront of electromagnetic waves. Particularly, with respect to the metasurface lenses, wide operational bandwidth and wide incident angle behavior are critically required for practical applications. Herein, a single-layer phase gradient metasurface lens is presented to achieve millimeter-wave focusing at a focal point of 13 mm regardless of the incident angle. The proposed metasurface lens is fabricated by constructing subwavelength-thick (< λ/10) phase elements composed of two metallic layers separated by a single dielectric substrate that exhibits low-Q resonance properties and a wide phase modulation range with satisfactory transmissivity. By controlling the spatial phase distribution, the proposed metasurface lens successfully realises effective wavefront manipulation properties and high-performance electromagnetic-wave-focusing characteristics over a wide operating frequency range from 35 to 40 GHz with incident angle independency up to 30°.Wonwoo LeeSemin JoKanghyeok LeeHong Soo ParkJunhyuk YangHa Young HongChangkun ParkSun K. HongHojin LeeNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-7 (2021)
institution DOAJ
collection DOAJ
language EN
topic Medicine
R
Science
Q
spellingShingle Medicine
R
Science
Q
Wonwoo Lee
Semin Jo
Kanghyeok Lee
Hong Soo Park
Junhyuk Yang
Ha Young Hong
Changkun Park
Sun K. Hong
Hojin Lee
Single-layer phase gradient mmWave metasurface for incident angle independent focusing
description Abstract Metasurfaces allow the rapid development of compact and flat electromagnetic devices owing to their capability in manipulating the wavefront of electromagnetic waves. Particularly, with respect to the metasurface lenses, wide operational bandwidth and wide incident angle behavior are critically required for practical applications. Herein, a single-layer phase gradient metasurface lens is presented to achieve millimeter-wave focusing at a focal point of 13 mm regardless of the incident angle. The proposed metasurface lens is fabricated by constructing subwavelength-thick (< λ/10) phase elements composed of two metallic layers separated by a single dielectric substrate that exhibits low-Q resonance properties and a wide phase modulation range with satisfactory transmissivity. By controlling the spatial phase distribution, the proposed metasurface lens successfully realises effective wavefront manipulation properties and high-performance electromagnetic-wave-focusing characteristics over a wide operating frequency range from 35 to 40 GHz with incident angle independency up to 30°.
format article
author Wonwoo Lee
Semin Jo
Kanghyeok Lee
Hong Soo Park
Junhyuk Yang
Ha Young Hong
Changkun Park
Sun K. Hong
Hojin Lee
author_facet Wonwoo Lee
Semin Jo
Kanghyeok Lee
Hong Soo Park
Junhyuk Yang
Ha Young Hong
Changkun Park
Sun K. Hong
Hojin Lee
author_sort Wonwoo Lee
title Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_short Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_full Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_fullStr Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_full_unstemmed Single-layer phase gradient mmWave metasurface for incident angle independent focusing
title_sort single-layer phase gradient mmwave metasurface for incident angle independent focusing
publisher Nature Portfolio
publishDate 2021
url https://doaj.org/article/67f7a476efe9450c8ee7d675af41a490
work_keys_str_mv AT wonwoolee singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT seminjo singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT kanghyeoklee singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT hongsoopark singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT junhyukyang singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT hayounghong singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT changkunpark singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT sunkhong singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
AT hojinlee singlelayerphasegradientmmwavemetasurfaceforincidentangleindependentfocusing
_version_ 1718385211167735808