Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells

Methods to monitor osmolarity-dependent changes in cell are currently lacking. Here the authors use the Arabidopsis intrinsically disordered AtLEA4-5 protein, which is expressed in plants under water deficit, to develop a FRET biosensor (SED1) to monitor osmotic stress.

Guardado en:

Detalles Bibliográficos
Autores principales:	Cesar L. Cuevas-Velazquez, Tamara Vellosillo, Karina Guadalupe, Hermann Broder Schmidt, Feng Yu, David Moses, Jennifer A. N. Brophy, Dante Cosio-Acosta, Alakananda Das, Lingxin Wang, Alexander M. Jones, Alejandra A. Covarrubias, Shahar Sukenik, José R. Dinneny
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Science Q
Acceso en línea:	https://doaj.org/article/6c5fabb7d3ce4541b5c43c9f778914b1
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:6c5fabb7d3ce4541b5c43c9f778914b1
record_format	dspace
spelling	oai:doaj.org-article:6c5fabb7d3ce4541b5c43c9f778914b12021-12-02T18:49:54ZIntrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells10.1038/s41467-021-25736-82041-1723https://doaj.org/article/6c5fabb7d3ce4541b5c43c9f778914b12021-09-01T00:00:00Zhttps://doi.org/10.1038/s41467-021-25736-8https://doaj.org/toc/2041-1723Methods to monitor osmolarity-dependent changes in cell are currently lacking. Here the authors use the Arabidopsis intrinsically disordered AtLEA4-5 protein, which is expressed in plants under water deficit, to develop a FRET biosensor (SED1) to monitor osmotic stress.Cesar L. Cuevas-VelazquezTamara VellosilloKarina GuadalupeHermann Broder SchmidtFeng YuDavid MosesJennifer A. N. BrophyDante Cosio-AcostaAlakananda DasLingxin WangAlexander M. JonesAlejandra A. CovarrubiasShahar SukenikJosé R. DinnenyNature PortfolioarticleScienceQENNature Communications, Vol 12, Iss 1, Pp 1-12 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Science Q
spellingShingle	Science Q Cesar L. Cuevas-Velazquez Tamara Vellosillo Karina Guadalupe Hermann Broder Schmidt Feng Yu David Moses Jennifer A. N. Brophy Dante Cosio-Acosta Alakananda Das Lingxin Wang Alexander M. Jones Alejandra A. Covarrubias Shahar Sukenik José R. Dinneny Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
description	Methods to monitor osmolarity-dependent changes in cell are currently lacking. Here the authors use the Arabidopsis intrinsically disordered AtLEA4-5 protein, which is expressed in plants under water deficit, to develop a FRET biosensor (SED1) to monitor osmotic stress.
format	article
author	Cesar L. Cuevas-Velazquez Tamara Vellosillo Karina Guadalupe Hermann Broder Schmidt Feng Yu David Moses Jennifer A. N. Brophy Dante Cosio-Acosta Alakananda Das Lingxin Wang Alexander M. Jones Alejandra A. Covarrubias Shahar Sukenik José R. Dinneny
author_facet	Cesar L. Cuevas-Velazquez Tamara Vellosillo Karina Guadalupe Hermann Broder Schmidt Feng Yu David Moses Jennifer A. N. Brophy Dante Cosio-Acosta Alakananda Das Lingxin Wang Alexander M. Jones Alejandra A. Covarrubias Shahar Sukenik José R. Dinneny
author_sort	Cesar L. Cuevas-Velazquez
title	Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_short	Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_full	Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_fullStr	Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_full_unstemmed	Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_sort	intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/6c5fabb7d3ce4541b5c43c9f778914b1
work_keys_str_mv	AT cesarlcuevasvelazquez intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT tamaravellosillo intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT karinaguadalupe intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT hermannbroderschmidt intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT fengyu intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT davidmoses intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT jenniferanbrophy intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT dantecosioacosta intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT alakanandadas intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT lingxinwang intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT alexandermjones intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT alejandraacovarrubias intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT shaharsukenik intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT joserdinneny intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
_version_	1718377510334365696

Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells

Ejemplares similares