Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix

Clostridioides difficile adenine methyltransferase A (CamA) is required for the sporulation and colonization of the pathogen that causes gastrointestinal infections. Here, the authors characterise CamA kinetically and present its crystal structure bound to the DNA recognition sequence, which reveals...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Jujun Zhou, John R. Horton, Robert M. Blumenthal, Xing Zhang, Xiaodong Cheng
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Science Q
Acceso en línea:	https://doaj.org/article/72d81f7c9e58495889a373df8da8fa71
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:72d81f7c9e58495889a373df8da8fa71
record_format	dspace
spelling	oai:doaj.org-article:72d81f7c9e58495889a373df8da8fa712021-12-02T17:34:47ZClostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix10.1038/s41467-021-23693-w2041-1723https://doaj.org/article/72d81f7c9e58495889a373df8da8fa712021-06-01T00:00:00Zhttps://doi.org/10.1038/s41467-021-23693-whttps://doaj.org/toc/2041-1723Clostridioides difficile adenine methyltransferase A (CamA) is required for the sporulation and colonization of the pathogen that causes gastrointestinal infections. Here, the authors characterise CamA kinetically and present its crystal structure bound to the DNA recognition sequence, which reveals DNA distortions including bending and the flipping of the target adenine out of the DNA helix, as well as protein conformational changes upon cofactor binding.Jujun ZhouJohn R. HortonRobert M. BlumenthalXing ZhangXiaodong ChengNature PortfolioarticleScienceQENNature Communications, Vol 12, Iss 1, Pp 1-12 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Science Q
spellingShingle	Science Q Jujun Zhou John R. Horton Robert M. Blumenthal Xing Zhang Xiaodong Cheng Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
description	Clostridioides difficile adenine methyltransferase A (CamA) is required for the sporulation and colonization of the pathogen that causes gastrointestinal infections. Here, the authors characterise CamA kinetically and present its crystal structure bound to the DNA recognition sequence, which reveals DNA distortions including bending and the flipping of the target adenine out of the DNA helix, as well as protein conformational changes upon cofactor binding.
format	article
author	Jujun Zhou John R. Horton Robert M. Blumenthal Xing Zhang Xiaodong Cheng
author_facet	Jujun Zhou John R. Horton Robert M. Blumenthal Xing Zhang Xiaodong Cheng
author_sort	Jujun Zhou
title	Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_short	Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_full	Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_fullStr	Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_full_unstemmed	Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_sort	clostridioides difficile specific dna adenine methyltransferase cama squeezes and flips adenine out of dna helix
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/72d81f7c9e58495889a373df8da8fa71
work_keys_str_mv	AT jujunzhou clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix AT johnrhorton clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix AT robertmblumenthal clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix AT xingzhang clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix AT xiaodongcheng clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix
_version_	1718379947384373248

Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix

Ejemplares similares