Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries

A few-layer graphene (FLG) composite material was synthesized using a rich reservoir and low-cost coal under the microwave-assisted catalytic graphitization process. X-ray diffraction, Raman spectroscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to evaluate th...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Faridul Islam, Jialong Wang, Arash Tahmasebi, Rou Wang, Behdad Moghtaderi, Jianglong Yu
Formato:	article
Lenguaje:	EN
Publicado:	MDPI AG 2021
Materias:	few-layer graphene coal catalytic graphitization lithium-ion batteries microwave Technology T Electrical engineering. Electronics. Nuclear engineering TK1-9971 Engineering (General). Civil engineering (General) TA1-2040 Microscopy QH201-278.5 Descriptive and experimental mechanics QC120-168.85
Acceso en línea:	https://doaj.org/article/732139d828e7402eb982311d0acf8d6f
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:732139d828e7402eb982311d0acf8d6f
record_format	dspace
spelling	oai:doaj.org-article:732139d828e7402eb982311d0acf8d6f2021-11-11T18:03:05ZMicrowave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries10.3390/ma142164681996-1944https://doaj.org/article/732139d828e7402eb982311d0acf8d6f2021-10-01T00:00:00Zhttps://www.mdpi.com/1996-1944/14/21/6468https://doaj.org/toc/1996-1944A few-layer graphene (FLG) composite material was synthesized using a rich reservoir and low-cost coal under the microwave-assisted catalytic graphitization process. X-ray diffraction, Raman spectroscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to evaluate the properties of the FLG sample. A well-developed microstructure and higher graphitization degree were achieved under microwave heating at 1300 °C using the S5% dual (Fe-Ni) catalyst for 20 min. In addition, the synthesized FLG sample encompassed the Raman spectrum 2D band at 2700 cm<sup>−1</sup>, which showed the existence of a few-layer graphene structure. The high-resolution TEM (transmission electron microscopy) image investigation of the S5% Fe-Ni sample confirmed that the fabricated FLG material consisted of two to seven graphitic layers, promoting the fast lithium-ion diffusion into the inner surface. The S5% Fe-Ni composite material delivered a high reversible capacity of 287.91 mAhg<sup>−1</sup> at 0.1 C with a higher Coulombic efficiency of 99.9%. In contrast, the single catalyst of S10% Fe contained a reversible capacity of 260.13 mAhg<sup>−1</sup> at 0.1 C with 97.96% Coulombic efficiency. Furthermore, the dual catalyst-loaded FLG sample demonstrated a high capacity—up to 95% of the initial reversible capacity retention—after 100 cycles. This study revealed the potential feasibility of producing FLG materials from bituminous coal used in a broad range as anode materials for lithium-ion batteries (LIBs).Faridul IslamJialong WangArash TahmasebiRou WangBehdad MoghtaderiJianglong YuMDPI AGarticlefew-layer graphenecoalcatalytic graphitizationlithium-ion batteriesmicrowaveTechnologyTElectrical engineering. Electronics. Nuclear engineeringTK1-9971Engineering (General). Civil engineering (General)TA1-2040MicroscopyQH201-278.5Descriptive and experimental mechanicsQC120-168.85ENMaterials, Vol 14, Iss 6468, p 6468 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	few-layer graphene coal catalytic graphitization lithium-ion batteries microwave Technology T Electrical engineering. Electronics. Nuclear engineering TK1-9971 Engineering (General). Civil engineering (General) TA1-2040 Microscopy QH201-278.5 Descriptive and experimental mechanics QC120-168.85
spellingShingle	few-layer graphene coal catalytic graphitization lithium-ion batteries microwave Technology T Electrical engineering. Electronics. Nuclear engineering TK1-9971 Engineering (General). Civil engineering (General) TA1-2040 Microscopy QH201-278.5 Descriptive and experimental mechanics QC120-168.85 Faridul Islam Jialong Wang Arash Tahmasebi Rou Wang Behdad Moghtaderi Jianglong Yu Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
description	A few-layer graphene (FLG) composite material was synthesized using a rich reservoir and low-cost coal under the microwave-assisted catalytic graphitization process. X-ray diffraction, Raman spectroscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy were used to evaluate the properties of the FLG sample. A well-developed microstructure and higher graphitization degree were achieved under microwave heating at 1300 °C using the S5% dual (Fe-Ni) catalyst for 20 min. In addition, the synthesized FLG sample encompassed the Raman spectrum 2D band at 2700 cm<sup>−1</sup>, which showed the existence of a few-layer graphene structure. The high-resolution TEM (transmission electron microscopy) image investigation of the S5% Fe-Ni sample confirmed that the fabricated FLG material consisted of two to seven graphitic layers, promoting the fast lithium-ion diffusion into the inner surface. The S5% Fe-Ni composite material delivered a high reversible capacity of 287.91 mAhg<sup>−1</sup> at 0.1 C with a higher Coulombic efficiency of 99.9%. In contrast, the single catalyst of S10% Fe contained a reversible capacity of 260.13 mAhg<sup>−1</sup> at 0.1 C with 97.96% Coulombic efficiency. Furthermore, the dual catalyst-loaded FLG sample demonstrated a high capacity—up to 95% of the initial reversible capacity retention—after 100 cycles. This study revealed the potential feasibility of producing FLG materials from bituminous coal used in a broad range as anode materials for lithium-ion batteries (LIBs).
format	article
author	Faridul Islam Jialong Wang Arash Tahmasebi Rou Wang Behdad Moghtaderi Jianglong Yu
author_facet	Faridul Islam Jialong Wang Arash Tahmasebi Rou Wang Behdad Moghtaderi Jianglong Yu
author_sort	Faridul Islam
title	Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
title_short	Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
title_full	Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
title_fullStr	Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
title_full_unstemmed	Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries
title_sort	microwave-assisted coal-derived few-layer graphene as an anode material for lithium-ion batteries
publisher	MDPI AG
publishDate	2021
url	https://doaj.org/article/732139d828e7402eb982311d0acf8d6f
work_keys_str_mv	AT faridulislam microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT jialongwang microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT arashtahmasebi microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT rouwang microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT behdadmoghtaderi microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries AT jianglongyu microwaveassistedcoalderivedfewlayergrapheneasananodematerialforlithiumionbatteries
_version_	1718431948972490752

Microwave-Assisted Coal-Derived Few-Layer Graphene as an Anode Material for Lithium-Ion Batteries

Ejemplares similares