Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens

Weili Yan1, Anekant Jain1, Ronan O&rsquo;Carra2,&nbsp; Jerold&nbsp;G Woodward3,&nbsp; Wenxue Li4, Guanhan Li4, Avindra Nath4,&nbsp; Russell J Mumper11Division of Molecular Pharmaceutics and the Center for Nanotechnology in Drug Delivery, UNC Eshelman School of...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Weili Yan, Anekant Jain, Ronan O&rsquo;Carra,&nbsp; Jerold&nbsp;G Woodward, et al.
Formato:	article
Lenguaje:	EN
Publicado:	Dove Medical Press 2009
Materias:	Immunologic diseases. Allergy RC581-607
Acceso en línea:	https://doaj.org/article/7706c45d7add429e9ae0378dccd0a4f7
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:7706c45d7add429e9ae0378dccd0a4f7
record_format	dspace
spelling	oai:doaj.org-article:7706c45d7add429e9ae0378dccd0a4f72021-12-02T06:27:37ZLipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens1179-1373https://doaj.org/article/7706c45d7add429e9ae0378dccd0a4f72009-07-01T00:00:00Zhttp://www.dovepress.com/lipid-nanoparticles-with-accessible-nickel-as-a-vaccine-delivery-syste-a3361https://doaj.org/toc/1179-1373Weili Yan1, Anekant Jain1, Ronan O&rsquo;Carra2,&nbsp; Jerold&nbsp;G Woodward3,&nbsp; Wenxue Li4, Guanhan Li4, Avindra Nath4,&nbsp; Russell J Mumper11Division of Molecular Pharmaceutics and the Center for Nanotechnology in Drug Delivery, UNC Eshelman School of Pharmacy, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 2Department of Pharmaceutical Sciences, College of Pharmacy, University of Kentucky; 3Department of Microbiology, Immunology and Molecular Genetics,&nbsp; University of Kentucky, Lexington, KY, USA; 4Department of Neurology, Johns Hopkins University, Baltimore, MD, USAAbstract: Lipid-based nanoparticles (NPs) with a small amount of surface-chelated nickel (Ni-NPs) were developed to easily formulate the human immunodeficiency virus (HIV) his-tagged Tat (his-Tat) protein, as well as to formulate and co-deliver two HIV antigens (his-p24 and his-Nef) on one particle. Female BALB/c mice were immunized by subcutaneous injection with his-Tat/Ni-NP formulation (1.5 &micro;g his-Tat/mouse) and control formulations on day 0 and 14. The day 28 anti-Tat specific immunoglobulin G titer with his-Tat/Ni-NPs was significantly greater than that with Alum/his-Tat. Furthermore, splenocytes from his-Tat/Ni-NP-immunized mice secreted significantly higher IFN-&gamma; than those from mice immunized with Alum/his-Tat. Although Ni-NPs did not show better adjuvant activity than Tat-coated anionic NPs made with sodium dodecyl sulfate (SDS/NPs), they were less toxic than SDS/NPs. The initial results indicated that co-immunization of mice using his-p24/his-Nef/Ni-NP induced greater antibody response compared to using Alum/his-p24/his-Nef. Co-delivery of two antigens using Ni-NPs also increased the immunogenicity of individual antigens compared to delivery of a single antigen by Ni-NPs. In conclusion, Ni-NPs are an efficient delivery system for HIV vaccines including both single antigen delivery and multiple antigen co-delivery.Keywords: nanoparticle, nickel, HIV, antigen co-delivery, vaccine Weili YanAnekant JainRonan O&rsquo;Carra,&nbsp; Jerold&nbsp;G Woodwardet al.Dove Medical PressarticleImmunologic diseases. AllergyRC581-607ENHIV/AIDS: Research and Palliative Care, Vol 2009, Iss Default, Pp 1-11 (2009)
institution	DOAJ
collection	DOAJ
language	EN
topic	Immunologic diseases. Allergy RC581-607
spellingShingle	Immunologic diseases. Allergy RC581-607 Weili Yan Anekant Jain Ronan O&rsquo;Carra,&nbsp; Jerold&nbsp;G Woodward et al. Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens
description	Weili Yan1, Anekant Jain1, Ronan O&rsquo;Carra2,&nbsp; Jerold&nbsp;G Woodward3,&nbsp; Wenxue Li4, Guanhan Li4, Avindra Nath4,&nbsp; Russell J Mumper11Division of Molecular Pharmaceutics and the Center for Nanotechnology in Drug Delivery, UNC Eshelman School of Pharmacy, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA; 2Department of Pharmaceutical Sciences, College of Pharmacy, University of Kentucky; 3Department of Microbiology, Immunology and Molecular Genetics,&nbsp; University of Kentucky, Lexington, KY, USA; 4Department of Neurology, Johns Hopkins University, Baltimore, MD, USAAbstract: Lipid-based nanoparticles (NPs) with a small amount of surface-chelated nickel (Ni-NPs) were developed to easily formulate the human immunodeficiency virus (HIV) his-tagged Tat (his-Tat) protein, as well as to formulate and co-deliver two HIV antigens (his-p24 and his-Nef) on one particle. Female BALB/c mice were immunized by subcutaneous injection with his-Tat/Ni-NP formulation (1.5 &micro;g his-Tat/mouse) and control formulations on day 0 and 14. The day 28 anti-Tat specific immunoglobulin G titer with his-Tat/Ni-NPs was significantly greater than that with Alum/his-Tat. Furthermore, splenocytes from his-Tat/Ni-NP-immunized mice secreted significantly higher IFN-&gamma; than those from mice immunized with Alum/his-Tat. Although Ni-NPs did not show better adjuvant activity than Tat-coated anionic NPs made with sodium dodecyl sulfate (SDS/NPs), they were less toxic than SDS/NPs. The initial results indicated that co-immunization of mice using his-p24/his-Nef/Ni-NP induced greater antibody response compared to using Alum/his-p24/his-Nef. Co-delivery of two antigens using Ni-NPs also increased the immunogenicity of individual antigens compared to delivery of a single antigen by Ni-NPs. In conclusion, Ni-NPs are an efficient delivery system for HIV vaccines including both single antigen delivery and multiple antigen co-delivery.Keywords: nanoparticle, nickel, HIV, antigen co-delivery, vaccine
format	article
author	Weili Yan Anekant Jain Ronan O&rsquo;Carra,&nbsp; Jerold&nbsp;G Woodward et al.
author_facet	Weili Yan Anekant Jain Ronan O&rsquo;Carra,&nbsp; Jerold&nbsp;G Woodward et al.
author_sort	Weili Yan
title	Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens
title_short	Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens
title_full	Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens
title_fullStr	Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens
title_full_unstemmed	Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens
title_sort	lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged hiv antigens
publisher	Dove Medical Press
publishDate	2009
url	https://doaj.org/article/7706c45d7add429e9ae0378dccd0a4f7
work_keys_str_mv	AT weiliyan lipidnanoparticleswithaccessiblenickelasavaccinedeliverysystemforsingleandmultiplehistaggedhivantigens AT anekantjain lipidnanoparticleswithaccessiblenickelasavaccinedeliverysystemforsingleandmultiplehistaggedhivantigens AT ronanoamprsquocarraampnbspjeroldampnbspgwoodward lipidnanoparticleswithaccessiblenickelasavaccinedeliverysystemforsingleandmultiplehistaggedhivantigens AT etal lipidnanoparticleswithaccessiblenickelasavaccinedeliverysystemforsingleandmultiplehistaggedhivantigens
_version_	1718399942362398720

Lipid nanoparticles with accessible nickel as a vaccine delivery system for single and multiple his-tagged HIV antigens

Ejemplares similares