Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
Abstract Calcium-dependent protein kinases (CDPKs) are encoded by a large gene family and play important roles against biotic and abiotic stresses and in plant growth and development. To date, little is known about the CDPK genes in strawberry (Fragaria x ananassa). In this study, analysis of Fragar...
Guardado en:
Autores principales: | , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Nature Portfolio
2020
|
Materias: | |
Acceso en línea: | https://doaj.org/article/775fae9719234c8bb0e8b53c71a30516 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:775fae9719234c8bb0e8b53c71a30516 |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:775fae9719234c8bb0e8b53c71a305162021-12-02T15:39:49ZGenome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa10.1038/s41598-020-67957-92045-2322https://doaj.org/article/775fae9719234c8bb0e8b53c71a305162020-07-01T00:00:00Zhttps://doi.org/10.1038/s41598-020-67957-9https://doaj.org/toc/2045-2322Abstract Calcium-dependent protein kinases (CDPKs) are encoded by a large gene family and play important roles against biotic and abiotic stresses and in plant growth and development. To date, little is known about the CDPK genes in strawberry (Fragaria x ananassa). In this study, analysis of Fragaria x ananassa CDPK gene family was performed, including gene structures, phylogeny, interactome and expression profiles. Nine new CDPK genes in Fragaria x ananassa were identified based on RNA-seq data. These identified strawberry FaCDPK genes were classified into four main groups, based on the phylogenetic analysis and structural features. FaCDPK genes were differentially expressed during fruit development and ripening, as well as in response to abiotic stress (salt and drought), and hormone (abscisic acid) treatment. In addition, the interaction network analysis pointed out proteins involved in the ABA-dependent response to plant stress via Ca2+ signaling, especially RBOHs. To our knowledge, this is the first report on CDPK families in Fragaria x ananassa, and it will provide valuable information for development of biofortified fruits and stress tolerant plants.Rosane Lopes CrizelEllen Cristina PerinIsabel Lopes VighiRafael WoloskiAmilton SeixasLuciano da Silva PintoCésar Valmor RombaldiVanessa GalliNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 10, Iss 1, Pp 1-17 (2020) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Rosane Lopes Crizel Ellen Cristina Perin Isabel Lopes Vighi Rafael Woloski Amilton Seixas Luciano da Silva Pinto César Valmor Rombaldi Vanessa Galli Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa |
description |
Abstract Calcium-dependent protein kinases (CDPKs) are encoded by a large gene family and play important roles against biotic and abiotic stresses and in plant growth and development. To date, little is known about the CDPK genes in strawberry (Fragaria x ananassa). In this study, analysis of Fragaria x ananassa CDPK gene family was performed, including gene structures, phylogeny, interactome and expression profiles. Nine new CDPK genes in Fragaria x ananassa were identified based on RNA-seq data. These identified strawberry FaCDPK genes were classified into four main groups, based on the phylogenetic analysis and structural features. FaCDPK genes were differentially expressed during fruit development and ripening, as well as in response to abiotic stress (salt and drought), and hormone (abscisic acid) treatment. In addition, the interaction network analysis pointed out proteins involved in the ABA-dependent response to plant stress via Ca2+ signaling, especially RBOHs. To our knowledge, this is the first report on CDPK families in Fragaria x ananassa, and it will provide valuable information for development of biofortified fruits and stress tolerant plants. |
format |
article |
author |
Rosane Lopes Crizel Ellen Cristina Perin Isabel Lopes Vighi Rafael Woloski Amilton Seixas Luciano da Silva Pinto César Valmor Rombaldi Vanessa Galli |
author_facet |
Rosane Lopes Crizel Ellen Cristina Perin Isabel Lopes Vighi Rafael Woloski Amilton Seixas Luciano da Silva Pinto César Valmor Rombaldi Vanessa Galli |
author_sort |
Rosane Lopes Crizel |
title |
Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa |
title_short |
Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa |
title_full |
Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa |
title_fullStr |
Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa |
title_full_unstemmed |
Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa |
title_sort |
genome-wide identification, and characterization of the cdpk gene family reveal their involvement in abiotic stress response in fragaria x ananassa |
publisher |
Nature Portfolio |
publishDate |
2020 |
url |
https://doaj.org/article/775fae9719234c8bb0e8b53c71a30516 |
work_keys_str_mv |
AT rosanelopescrizel genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT ellencristinaperin genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT isabellopesvighi genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT rafaelwoloski genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT amiltonseixas genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT lucianodasilvapinto genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT cesarvalmorrombaldi genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT vanessagalli genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa |
_version_ |
1718385881400737792 |