Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa

Abstract Calcium-dependent protein kinases (CDPKs) are encoded by a large gene family and play important roles against biotic and abiotic stresses and in plant growth and development. To date, little is known about the CDPK genes in strawberry (Fragaria x ananassa). In this study, analysis of Fragar...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Rosane Lopes Crizel, Ellen Cristina Perin, Isabel Lopes Vighi, Rafael Woloski, Amilton Seixas, Luciano da Silva Pinto, César Valmor Rombaldi, Vanessa Galli
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2020
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/775fae9719234c8bb0e8b53c71a30516
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:775fae9719234c8bb0e8b53c71a30516
record_format	dspace
spelling	oai:doaj.org-article:775fae9719234c8bb0e8b53c71a305162021-12-02T15:39:49ZGenome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa10.1038/s41598-020-67957-92045-2322https://doaj.org/article/775fae9719234c8bb0e8b53c71a305162020-07-01T00:00:00Zhttps://doi.org/10.1038/s41598-020-67957-9https://doaj.org/toc/2045-2322Abstract Calcium-dependent protein kinases (CDPKs) are encoded by a large gene family and play important roles against biotic and abiotic stresses and in plant growth and development. To date, little is known about the CDPK genes in strawberry (Fragaria x ananassa). In this study, analysis of Fragaria x ananassa CDPK gene family was performed, including gene structures, phylogeny, interactome and expression profiles. Nine new CDPK genes in Fragaria x ananassa were identified based on RNA-seq data. These identified strawberry FaCDPK genes were classified into four main groups, based on the phylogenetic analysis and structural features. FaCDPK genes were differentially expressed during fruit development and ripening, as well as in response to abiotic stress (salt and drought), and hormone (abscisic acid) treatment. In addition, the interaction network analysis pointed out proteins involved in the ABA-dependent response to plant stress via Ca2+ signaling, especially RBOHs. To our knowledge, this is the first report on CDPK families in Fragaria x ananassa, and it will provide valuable information for development of biofortified fruits and stress tolerant plants.Rosane Lopes CrizelEllen Cristina PerinIsabel Lopes VighiRafael WoloskiAmilton SeixasLuciano da Silva PintoCésar Valmor RombaldiVanessa GalliNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 10, Iss 1, Pp 1-17 (2020)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Rosane Lopes Crizel Ellen Cristina Perin Isabel Lopes Vighi Rafael Woloski Amilton Seixas Luciano da Silva Pinto César Valmor Rombaldi Vanessa Galli Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
description	Abstract Calcium-dependent protein kinases (CDPKs) are encoded by a large gene family and play important roles against biotic and abiotic stresses and in plant growth and development. To date, little is known about the CDPK genes in strawberry (Fragaria x ananassa). In this study, analysis of Fragaria x ananassa CDPK gene family was performed, including gene structures, phylogeny, interactome and expression profiles. Nine new CDPK genes in Fragaria x ananassa were identified based on RNA-seq data. These identified strawberry FaCDPK genes were classified into four main groups, based on the phylogenetic analysis and structural features. FaCDPK genes were differentially expressed during fruit development and ripening, as well as in response to abiotic stress (salt and drought), and hormone (abscisic acid) treatment. In addition, the interaction network analysis pointed out proteins involved in the ABA-dependent response to plant stress via Ca2+ signaling, especially RBOHs. To our knowledge, this is the first report on CDPK families in Fragaria x ananassa, and it will provide valuable information for development of biofortified fruits and stress tolerant plants.
format	article
author	Rosane Lopes Crizel Ellen Cristina Perin Isabel Lopes Vighi Rafael Woloski Amilton Seixas Luciano da Silva Pinto César Valmor Rombaldi Vanessa Galli
author_facet	Rosane Lopes Crizel Ellen Cristina Perin Isabel Lopes Vighi Rafael Woloski Amilton Seixas Luciano da Silva Pinto César Valmor Rombaldi Vanessa Galli
author_sort	Rosane Lopes Crizel
title	Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
title_short	Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
title_full	Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
title_fullStr	Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
title_full_unstemmed	Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa
title_sort	genome-wide identification, and characterization of the cdpk gene family reveal their involvement in abiotic stress response in fragaria x ananassa
publisher	Nature Portfolio
publishDate	2020
url	https://doaj.org/article/775fae9719234c8bb0e8b53c71a30516
work_keys_str_mv	AT rosanelopescrizel genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT ellencristinaperin genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT isabellopesvighi genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT rafaelwoloski genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT amiltonseixas genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT lucianodasilvapinto genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT cesarvalmorrombaldi genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa AT vanessagalli genomewideidentificationandcharacterizationofthecdpkgenefamilyrevealtheirinvolvementinabioticstressresponseinfragariaxananassa
_version_	1718385881400737792

Genome-wide identification, and characterization of the CDPK gene family reveal their involvement in abiotic stress response in Fragaria x ananassa

Ejemplares similares