Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection
ABSTRACT Strains of Pseudomonas aeruginosa with deficiencies in DNA mismatch repair have been studied in the context of chronic infection, where elevated mutational rates (“hypermutation”) may facilitate the acquisition of antimicrobial resistance. Whether P. aeruginosa hypermutation can also play a...
Guardado en:
Autores principales: | , , , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
American Society for Microbiology
2019
|
Materias: | |
Acceso en línea: | https://doaj.org/article/7f73195dff6c40008b4e1528001c23e0 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:7f73195dff6c40008b4e1528001c23e0 |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:7f73195dff6c40008b4e1528001c23e02021-11-15T15:59:41ZDynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection10.1128/mBio.01822-192150-7511https://doaj.org/article/7f73195dff6c40008b4e1528001c23e02019-10-01T00:00:00Zhttps://journals.asm.org/doi/10.1128/mBio.01822-19https://doaj.org/toc/2150-7511ABSTRACT Strains of Pseudomonas aeruginosa with deficiencies in DNA mismatch repair have been studied in the context of chronic infection, where elevated mutational rates (“hypermutation”) may facilitate the acquisition of antimicrobial resistance. Whether P. aeruginosa hypermutation can also play an adaptive role in the more dynamic context of acute infection remains unclear. In this work, we demonstrate that evolved mismatch repair deficiencies may be exploited by P. aeruginosa to facilitate rapid acquisition of antimicrobial resistance in acute infection, and we directly document rapid clonal succession by such a hypermutating lineage in a patient. Whole-genome sequencing (WGS) was performed on nine serially cultured blood and respiratory isolates from a patient in whom ceftazidime-avibactam (CZA) resistance emerged in vivo over the course of days. The CZA-resistant clone was differentiated by 14 mutations, including a gain-of-function G183D substitution in the PDC-5 chromosomal AmpC cephalosporinase conferring CZA resistance. This lineage also contained a substitution (R656H) at a conserved position in the ATPase domain of the MutS mismatch repair (MMR) protein, and elevated mutational rates were confirmed by mutational accumulation experiments with WGS of evolved lineages in conjunction with rifampin resistance assays. To test whether MMR-deficient hypermutation could facilitate rapid acquisition of CZA resistance, in vitro adaptive evolution experiments were performed with a mutS-deficient strain. These experiments demonstrated rapid hypermutation-facilitated acquisition of CZA resistance compared with the isogenic wild-type strain. Our results suggest a possibly underappreciated role for evolved MMR deficiency in facilitating rapid adaptive evolution of P. aeruginosa in the context of acute infection. IMPORTANCE Antimicrobial resistance in bacteria represents one of the most consequential problems in modern medicine, and its emergence and spread threaten to compromise central advances in the treatment of infectious diseases. Ceftazidime-avibactam (CZA) belongs to a new class of broad-spectrum beta-lactam/beta-lactamase inhibitor combinations designed to treat infections caused by multidrug-resistant bacteria. Understanding the emergence of resistance to this important new drug class is of critical importance. In this work, we demonstrate that evolved mismatch repair deficiency in P. aeruginosa, an important pathogen responsible for significant morbidity and mortality among hospitalized patients, may facilitate rapid acquisition of resistance to CZA in the context of acute infection. These findings are relevant for both diagnosis and treatment of antimicrobial resistance emerging in acute infection in the hypermutator background and additionally have implications for the emergence of more virulent phenotypes.Pavel P. KhilAugusto Dulanto ChiangJonathan HoJung-Ho YounJamie K. LemonJuan Gea-BanaclocheKaren M. FrankMark PartaRobert A. BonomoJohn P. DekkerAmerican Society for MicrobiologyarticlePseudomonas aeruginosaantimicrobial agentsbacterial evolutionceftazidime-avibactamhost-pathogen interactionshypermutatorMicrobiologyQR1-502ENmBio, Vol 10, Iss 5 (2019) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Pseudomonas aeruginosa antimicrobial agents bacterial evolution ceftazidime-avibactam host-pathogen interactions hypermutator Microbiology QR1-502 |
spellingShingle |
Pseudomonas aeruginosa antimicrobial agents bacterial evolution ceftazidime-avibactam host-pathogen interactions hypermutator Microbiology QR1-502 Pavel P. Khil Augusto Dulanto Chiang Jonathan Ho Jung-Ho Youn Jamie K. Lemon Juan Gea-Banacloche Karen M. Frank Mark Parta Robert A. Bonomo John P. Dekker Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection |
description |
ABSTRACT Strains of Pseudomonas aeruginosa with deficiencies in DNA mismatch repair have been studied in the context of chronic infection, where elevated mutational rates (“hypermutation”) may facilitate the acquisition of antimicrobial resistance. Whether P. aeruginosa hypermutation can also play an adaptive role in the more dynamic context of acute infection remains unclear. In this work, we demonstrate that evolved mismatch repair deficiencies may be exploited by P. aeruginosa to facilitate rapid acquisition of antimicrobial resistance in acute infection, and we directly document rapid clonal succession by such a hypermutating lineage in a patient. Whole-genome sequencing (WGS) was performed on nine serially cultured blood and respiratory isolates from a patient in whom ceftazidime-avibactam (CZA) resistance emerged in vivo over the course of days. The CZA-resistant clone was differentiated by 14 mutations, including a gain-of-function G183D substitution in the PDC-5 chromosomal AmpC cephalosporinase conferring CZA resistance. This lineage also contained a substitution (R656H) at a conserved position in the ATPase domain of the MutS mismatch repair (MMR) protein, and elevated mutational rates were confirmed by mutational accumulation experiments with WGS of evolved lineages in conjunction with rifampin resistance assays. To test whether MMR-deficient hypermutation could facilitate rapid acquisition of CZA resistance, in vitro adaptive evolution experiments were performed with a mutS-deficient strain. These experiments demonstrated rapid hypermutation-facilitated acquisition of CZA resistance compared with the isogenic wild-type strain. Our results suggest a possibly underappreciated role for evolved MMR deficiency in facilitating rapid adaptive evolution of P. aeruginosa in the context of acute infection. IMPORTANCE Antimicrobial resistance in bacteria represents one of the most consequential problems in modern medicine, and its emergence and spread threaten to compromise central advances in the treatment of infectious diseases. Ceftazidime-avibactam (CZA) belongs to a new class of broad-spectrum beta-lactam/beta-lactamase inhibitor combinations designed to treat infections caused by multidrug-resistant bacteria. Understanding the emergence of resistance to this important new drug class is of critical importance. In this work, we demonstrate that evolved mismatch repair deficiency in P. aeruginosa, an important pathogen responsible for significant morbidity and mortality among hospitalized patients, may facilitate rapid acquisition of resistance to CZA in the context of acute infection. These findings are relevant for both diagnosis and treatment of antimicrobial resistance emerging in acute infection in the hypermutator background and additionally have implications for the emergence of more virulent phenotypes. |
format |
article |
author |
Pavel P. Khil Augusto Dulanto Chiang Jonathan Ho Jung-Ho Youn Jamie K. Lemon Juan Gea-Banacloche Karen M. Frank Mark Parta Robert A. Bonomo John P. Dekker |
author_facet |
Pavel P. Khil Augusto Dulanto Chiang Jonathan Ho Jung-Ho Youn Jamie K. Lemon Juan Gea-Banacloche Karen M. Frank Mark Parta Robert A. Bonomo John P. Dekker |
author_sort |
Pavel P. Khil |
title |
Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection |
title_short |
Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection |
title_full |
Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection |
title_fullStr |
Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection |
title_full_unstemmed |
Dynamic Emergence of Mismatch Repair Deficiency Facilitates Rapid Evolution of Ceftazidime-Avibactam Resistance in <named-content content-type="genus-species">Pseudomonas aeruginosa</named-content> Acute Infection |
title_sort |
dynamic emergence of mismatch repair deficiency facilitates rapid evolution of ceftazidime-avibactam resistance in <named-content content-type="genus-species">pseudomonas aeruginosa</named-content> acute infection |
publisher |
American Society for Microbiology |
publishDate |
2019 |
url |
https://doaj.org/article/7f73195dff6c40008b4e1528001c23e0 |
work_keys_str_mv |
AT pavelpkhil dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT augustodulantochiang dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT jonathanho dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT junghoyoun dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT jamieklemon dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT juangeabanacloche dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT karenmfrank dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT markparta dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT robertabonomo dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection AT johnpdekker dynamicemergenceofmismatchrepairdeficiencyfacilitatesrapidevolutionofceftazidimeavibactamresistanceinnamedcontentcontenttypegenusspeciespseudomonasaeruginosanamedcontentacuteinfection |
_version_ |
1718426977539457024 |