New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis
Abstract. Nguyen XV, Nguyen TH, Dao VH, Liao L. 2019. New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis. Biodiversitas 20: 688-695. Members of Grateloupia show highly diverse morphological traits, and this make...
Guardado en:
Autores principales: | , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
MBI & UNS Solo
2019
|
Materias: | |
Acceso en línea: | https://doaj.org/article/806f0bb26d8b43f484273532c8744033 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:806f0bb26d8b43f484273532c8744033 |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:806f0bb26d8b43f484273532c87440332021-11-16T14:12:15ZNew record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis1412-033X2085-472210.13057/biodiv/d200311https://doaj.org/article/806f0bb26d8b43f484273532c87440332019-02-01T00:00:00Zhttps://smujo.id/biodiv/article/view/3351https://doaj.org/toc/1412-033Xhttps://doaj.org/toc/2085-4722Abstract. Nguyen XV, Nguyen TH, Dao VH, Liao L. 2019. New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis. Biodiversitas 20: 688-695. Members of Grateloupia show highly diverse morphological traits, and this makes species classification more difficult. Samples were found growing with other marine algae nearshore, 3–5 m depth at Da Nang City. Morphological observation of vegetative and reproductive structures as well as phylogenetic analysis based on the large subunit of ribulose-1,5-bisphosphate-carboxylase-oxygenase (rbcL) sequence confirmed its identification. Phylogeny of members of Grateloupia inferred from Bayesian Inference, Maximum Likelihood, Maximum Parsimony and Neighbour Joining indicated materials collected in Vietnam compared well with known G. taiwanensis from the type locality, with very little sequence divergence. Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang is therefore reported for the first time from Vietnam.XUAN-VY XUAN-NGUYENTRUNG-HIEU NGUYENVIET-HA DAOLAWRENCE LIAOMBI & UNS SoloarticleBiology (General)QH301-705.5ENBiodiversitas, Vol 20, Iss 3, Pp 688-695 (2019) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Biology (General) QH301-705.5 |
spellingShingle |
Biology (General) QH301-705.5 XUAN-VY XUAN-NGUYEN TRUNG-HIEU NGUYEN VIET-HA DAO LAWRENCE LIAO New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis |
description |
Abstract. Nguyen XV, Nguyen TH, Dao VH, Liao L. 2019. New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis. Biodiversitas 20: 688-695. Members of Grateloupia show highly diverse morphological traits, and this makes species classification more difficult. Samples were found growing with other marine algae nearshore, 3–5 m depth at Da Nang City. Morphological observation of vegetative and reproductive structures as well as phylogenetic analysis based on the large subunit of ribulose-1,5-bisphosphate-carboxylase-oxygenase (rbcL) sequence confirmed its identification. Phylogeny of members of Grateloupia inferred from Bayesian Inference, Maximum Likelihood, Maximum Parsimony and Neighbour Joining indicated materials collected in Vietnam compared well with known G. taiwanensis from the type locality, with very little sequence divergence. Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang is therefore reported for the first time from Vietnam. |
format |
article |
author |
XUAN-VY XUAN-NGUYEN TRUNG-HIEU NGUYEN VIET-HA DAO LAWRENCE LIAO |
author_facet |
XUAN-VY XUAN-NGUYEN TRUNG-HIEU NGUYEN VIET-HA DAO LAWRENCE LIAO |
author_sort |
XUAN-VY XUAN-NGUYEN |
title |
New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis |
title_short |
New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis |
title_full |
New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis |
title_fullStr |
New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis |
title_full_unstemmed |
New record of Grateloupia taiwanensis S.-M. Lin et H.-Y. Liang in Vietnam: Evidence of morphological observation and rbcL sequence analysis |
title_sort |
new record of grateloupia taiwanensis s.-m. lin et h.-y. liang in vietnam: evidence of morphological observation and rbcl sequence analysis |
publisher |
MBI & UNS Solo |
publishDate |
2019 |
url |
https://doaj.org/article/806f0bb26d8b43f484273532c8744033 |
work_keys_str_mv |
AT xuanvyxuannguyen newrecordofgrateloupiataiwanensissmlinethylianginvietnamevidenceofmorphologicalobservationandrbclsequenceanalysis AT trunghieunguyen newrecordofgrateloupiataiwanensissmlinethylianginvietnamevidenceofmorphologicalobservationandrbclsequenceanalysis AT viethadao newrecordofgrateloupiataiwanensissmlinethylianginvietnamevidenceofmorphologicalobservationandrbclsequenceanalysis AT lawrenceliao newrecordofgrateloupiataiwanensissmlinethylianginvietnamevidenceofmorphologicalobservationandrbclsequenceanalysis |
_version_ |
1718426368387055616 |