Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes

Cell membranes are not homogenous but compartmentalized into lateral microdomains, which are considered as biochemical reaction centers for various physiological processes in eukaryotes and prokaryotes. Due to their special lipid and protein composition, some of these microdomains are resistant to t...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Simon Czolkoss, Xenia Safronov, Sascha Rexroth, Lisa R. Knoke, Meriyem Aktas, Franz Narberhaus
Formato:	article
Lenguaje:	EN
Publicado:	Frontiers Media S.A. 2021
Materias:	Agrobacterium membrane organization detergent-resistant membranes type IV secretion system type VI secretion system membrane microdomains Microbiology QR1-502
Acceso en línea:	https://doaj.org/article/8ce69ef9e8c246e28e2c9bdaef6552ee
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:8ce69ef9e8c246e28e2c9bdaef6552ee
record_format	dspace
spelling	oai:doaj.org-article:8ce69ef9e8c246e28e2c9bdaef6552ee2021-12-01T01:50:06ZAgrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes1664-302X10.3389/fmicb.2021.754486https://doaj.org/article/8ce69ef9e8c246e28e2c9bdaef6552ee2021-11-01T00:00:00Zhttps://www.frontiersin.org/articles/10.3389/fmicb.2021.754486/fullhttps://doaj.org/toc/1664-302XCell membranes are not homogenous but compartmentalized into lateral microdomains, which are considered as biochemical reaction centers for various physiological processes in eukaryotes and prokaryotes. Due to their special lipid and protein composition, some of these microdomains are resistant to treatment with non-ionic detergents and can be purified as detergent-resistant membranes (DRMs). Here we report the proteome of DRMs from the Gram-negative phytopathogen Agrobacterium tumefaciens. Using label-free liquid chromatography-tandem mass spectrometry, we identified proteins enriched in DRMs isolated under normal and virulence-mimicking growth conditions. Prominent microdomain marker proteins such as the SPFH (stomatin/prohibitin/flotillin/HflKC) proteins HflK, HflC and Atu3772, along with the protease FtsH were highly enriched in DRMs isolated under any given condition. Moreover, proteins involved in cell envelope biogenesis, transport and secretion, as well as motility- and chemotaxis-associated proteins were overrepresented in DRMs. Most strikingly, we found virulence-associated proteins such as the VirA/VirG two-component system, and the membrane-spanning type IV and type VI secretion systems enriched in DRMs. Fluorescence microscopy of the cellular localization of both secretion systems and of marker proteins was in agreement with the results from the proteomics approach. These findings suggest that virulence traits are micro-compartmentalized into functional microdomains in A. tumefaciens.Simon CzolkossXenia SafronovSascha RexrothLisa R. KnokeMeriyem AktasFranz NarberhausFrontiers Media S.A.articleAgrobacteriummembrane organizationdetergent-resistant membranestype IV secretion systemtype VI secretion systemmembrane microdomainsMicrobiologyQR1-502ENFrontiers in Microbiology, Vol 12 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Agrobacterium membrane organization detergent-resistant membranes type IV secretion system type VI secretion system membrane microdomains Microbiology QR1-502
spellingShingle	Agrobacterium membrane organization detergent-resistant membranes type IV secretion system type VI secretion system membrane microdomains Microbiology QR1-502 Simon Czolkoss Xenia Safronov Sascha Rexroth Lisa R. Knoke Meriyem Aktas Franz Narberhaus Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes
description	Cell membranes are not homogenous but compartmentalized into lateral microdomains, which are considered as biochemical reaction centers for various physiological processes in eukaryotes and prokaryotes. Due to their special lipid and protein composition, some of these microdomains are resistant to treatment with non-ionic detergents and can be purified as detergent-resistant membranes (DRMs). Here we report the proteome of DRMs from the Gram-negative phytopathogen Agrobacterium tumefaciens. Using label-free liquid chromatography-tandem mass spectrometry, we identified proteins enriched in DRMs isolated under normal and virulence-mimicking growth conditions. Prominent microdomain marker proteins such as the SPFH (stomatin/prohibitin/flotillin/HflKC) proteins HflK, HflC and Atu3772, along with the protease FtsH were highly enriched in DRMs isolated under any given condition. Moreover, proteins involved in cell envelope biogenesis, transport and secretion, as well as motility- and chemotaxis-associated proteins were overrepresented in DRMs. Most strikingly, we found virulence-associated proteins such as the VirA/VirG two-component system, and the membrane-spanning type IV and type VI secretion systems enriched in DRMs. Fluorescence microscopy of the cellular localization of both secretion systems and of marker proteins was in agreement with the results from the proteomics approach. These findings suggest that virulence traits are micro-compartmentalized into functional microdomains in A. tumefaciens.
format	article
author	Simon Czolkoss Xenia Safronov Sascha Rexroth Lisa R. Knoke Meriyem Aktas Franz Narberhaus
author_facet	Simon Czolkoss Xenia Safronov Sascha Rexroth Lisa R. Knoke Meriyem Aktas Franz Narberhaus
author_sort	Simon Czolkoss
title	Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes
title_short	Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes
title_full	Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes
title_fullStr	Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes
title_full_unstemmed	Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes
title_sort	agrobacterium tumefaciens type iv and type vi secretion systems reside in detergent-resistant membranes
publisher	Frontiers Media S.A.
publishDate	2021
url	https://doaj.org/article/8ce69ef9e8c246e28e2c9bdaef6552ee
work_keys_str_mv	AT simonczolkoss agrobacteriumtumefacienstypeivandtypevisecretionsystemsresideindetergentresistantmembranes AT xeniasafronov agrobacteriumtumefacienstypeivandtypevisecretionsystemsresideindetergentresistantmembranes AT sascharexroth agrobacteriumtumefacienstypeivandtypevisecretionsystemsresideindetergentresistantmembranes AT lisarknoke agrobacteriumtumefacienstypeivandtypevisecretionsystemsresideindetergentresistantmembranes AT meriyemaktas agrobacteriumtumefacienstypeivandtypevisecretionsystemsresideindetergentresistantmembranes AT franznarberhaus agrobacteriumtumefacienstypeivandtypevisecretionsystemsresideindetergentresistantmembranes
_version_	1718405974371336192

Agrobacterium tumefaciens Type IV and Type VI Secretion Systems Reside in Detergent-Resistant Membranes

Ejemplares similares