The association between self-reported stress and cardiovascular measures in daily life: A systematic review
<h4>Background</h4> Stress plays an important role in the development of mental illness, and an increasing number of studies is trying to detect moments of perceived stress in everyday life based on physiological data gathered using ambulatory devices. However, based on laboratory studie...
Saved in:
Main Authors: | , , , , , , |
---|---|
Format: | article |
Language: | EN |
Published: |
Public Library of Science (PLoS)
2021
|
Subjects: | |
Online Access: | https://doaj.org/article/8cfdbed87fb14f51a787aadcb8527e8f |
Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
id |
oai:doaj.org-article:8cfdbed87fb14f51a787aadcb8527e8f |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:8cfdbed87fb14f51a787aadcb8527e8f2021-11-25T06:19:28ZThe association between self-reported stress and cardiovascular measures in daily life: A systematic review1932-6203https://doaj.org/article/8cfdbed87fb14f51a787aadcb8527e8f2021-01-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/PMC8604333/?tool=EBIhttps://doaj.org/toc/1932-6203<h4>Background</h4> Stress plays an important role in the development of mental illness, and an increasing number of studies is trying to detect moments of perceived stress in everyday life based on physiological data gathered using ambulatory devices. However, based on laboratory studies, there is only modest evidence for a relationship between self-reported stress and physiological ambulatory measures. This descriptive systematic review evaluates the evidence for studies investigating an association between self-reported stress and physiological measures under daily life conditions. <h4>Methods</h4> Three databases were searched for articles assessing an association between self-reported stress and cardiovascular and skin conductance measures simultaneously over the course of at least a day. <h4>Results</h4> We reviewed findings of 36 studies investigating an association between self-reported stress and cardiovascular measures with overall 135 analyses of associations between self-reported stress and cardiovascular measures. Overall, 35% of all analyses showed a significant or marginally significant association in the expected direction. The most consistent results were found for perceived stress, high-arousal negative affect scales, and event-related self-reported stress measures, and for frequency-domain heart rate variability physiological measures. There was much heterogeneity in measures and methods. <h4>Conclusion</h4> These findings confirm that daily-life stress-dynamics are complex and require a better understanding. Choices in design and measurement seem to play a role. We provide some guidance for future studies.Thomas VaessenAki RintalaNatalya OtsabrykWolfgang ViechtbauerMartien WampersStephan ClaesInez Myin-GermeysPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 16, Iss 11 (2021) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Thomas Vaessen Aki Rintala Natalya Otsabryk Wolfgang Viechtbauer Martien Wampers Stephan Claes Inez Myin-Germeys The association between self-reported stress and cardiovascular measures in daily life: A systematic review |
description |
<h4>Background</h4> Stress plays an important role in the development of mental illness, and an increasing number of studies is trying to detect moments of perceived stress in everyday life based on physiological data gathered using ambulatory devices. However, based on laboratory studies, there is only modest evidence for a relationship between self-reported stress and physiological ambulatory measures. This descriptive systematic review evaluates the evidence for studies investigating an association between self-reported stress and physiological measures under daily life conditions. <h4>Methods</h4> Three databases were searched for articles assessing an association between self-reported stress and cardiovascular and skin conductance measures simultaneously over the course of at least a day. <h4>Results</h4> We reviewed findings of 36 studies investigating an association between self-reported stress and cardiovascular measures with overall 135 analyses of associations between self-reported stress and cardiovascular measures. Overall, 35% of all analyses showed a significant or marginally significant association in the expected direction. The most consistent results were found for perceived stress, high-arousal negative affect scales, and event-related self-reported stress measures, and for frequency-domain heart rate variability physiological measures. There was much heterogeneity in measures and methods. <h4>Conclusion</h4> These findings confirm that daily-life stress-dynamics are complex and require a better understanding. Choices in design and measurement seem to play a role. We provide some guidance for future studies. |
format |
article |
author |
Thomas Vaessen Aki Rintala Natalya Otsabryk Wolfgang Viechtbauer Martien Wampers Stephan Claes Inez Myin-Germeys |
author_facet |
Thomas Vaessen Aki Rintala Natalya Otsabryk Wolfgang Viechtbauer Martien Wampers Stephan Claes Inez Myin-Germeys |
author_sort |
Thomas Vaessen |
title |
The association between self-reported stress and cardiovascular measures in daily life: A systematic review |
title_short |
The association between self-reported stress and cardiovascular measures in daily life: A systematic review |
title_full |
The association between self-reported stress and cardiovascular measures in daily life: A systematic review |
title_fullStr |
The association between self-reported stress and cardiovascular measures in daily life: A systematic review |
title_full_unstemmed |
The association between self-reported stress and cardiovascular measures in daily life: A systematic review |
title_sort |
association between self-reported stress and cardiovascular measures in daily life: a systematic review |
publisher |
Public Library of Science (PLoS) |
publishDate |
2021 |
url |
https://doaj.org/article/8cfdbed87fb14f51a787aadcb8527e8f |
work_keys_str_mv |
AT thomasvaessen theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT akirintala theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT natalyaotsabryk theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT wolfgangviechtbauer theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT martienwampers theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT stephanclaes theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT inezmyingermeys theassociationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT thomasvaessen associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT akirintala associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT natalyaotsabryk associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT wolfgangviechtbauer associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT martienwampers associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT stephanclaes associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview AT inezmyingermeys associationbetweenselfreportedstressandcardiovascularmeasuresindailylifeasystematicreview |
_version_ |
1718413876111867904 |