Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis

Abstract The molecular mechanism of muscle atrophy has been studied a lot, but there is no comprehensive analysis focusing on the denervated muscle atrophy. The gene network that controls the development of denervated muscle atrophy needs further elucidation. We examined differentially expressed gen...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Xinyi Gu, Bo Jin, Zhidan Qi, Xiaofeng Yin
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/93e2bd0f4a63432a9eec301b9229b057
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:93e2bd0f4a63432a9eec301b9229b057
record_format	dspace
spelling	oai:doaj.org-article:93e2bd0f4a63432a9eec301b9229b0572021-12-02T16:31:42ZIdentification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis10.1038/s41598-021-92489-12045-2322https://doaj.org/article/93e2bd0f4a63432a9eec301b9229b0572021-06-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-92489-1https://doaj.org/toc/2045-2322Abstract The molecular mechanism of muscle atrophy has been studied a lot, but there is no comprehensive analysis focusing on the denervated muscle atrophy. The gene network that controls the development of denervated muscle atrophy needs further elucidation. We examined differentially expressed genes (DEGs) from five denervated muscle atrophy microarray datasets and predicted microRNAs that target these DEGs. We also included the differentially expressed microRNAs datasets of denervated muscle atrophy in previous studies as background information to identify potential key microRNAs. Finally, we compared denervated muscle atrophy with disuse muscle atrophy caused by other reasons, and obtained the Den-genes which only differentially expressed in denervated muscle atrophy. In this meta-analysis, we obtained 429 up-regulated genes, 525 down-regulated genes and a batch of key microRNAs in denervated muscle atrophy. We found eight important microRNA-mRNA interactions (miR-1/Jun, miR-1/Vegfa, miR-497/Vegfa, miR-23a/Vegfa, miR-206/Vegfa, miR-497/Suclg1, miR-27a/Suclg1, miR-27a/Mapk14). The top five KEGG pathways enriched by Den-genes are Insulin signaling pathway, T cell receptor signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway and B cell receptor signaling pathway. Our research has delineated the RNA regulatory network of denervated muscle atrophy, and uncovered the specific genes and terms in denervated muscle atrophy.Xinyi GuBo JinZhidan QiXiaofeng YinNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-15 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Xinyi Gu Bo Jin Zhidan Qi Xiaofeng Yin Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis
description	Abstract The molecular mechanism of muscle atrophy has been studied a lot, but there is no comprehensive analysis focusing on the denervated muscle atrophy. The gene network that controls the development of denervated muscle atrophy needs further elucidation. We examined differentially expressed genes (DEGs) from five denervated muscle atrophy microarray datasets and predicted microRNAs that target these DEGs. We also included the differentially expressed microRNAs datasets of denervated muscle atrophy in previous studies as background information to identify potential key microRNAs. Finally, we compared denervated muscle atrophy with disuse muscle atrophy caused by other reasons, and obtained the Den-genes which only differentially expressed in denervated muscle atrophy. In this meta-analysis, we obtained 429 up-regulated genes, 525 down-regulated genes and a batch of key microRNAs in denervated muscle atrophy. We found eight important microRNA-mRNA interactions (miR-1/Jun, miR-1/Vegfa, miR-497/Vegfa, miR-23a/Vegfa, miR-206/Vegfa, miR-497/Suclg1, miR-27a/Suclg1, miR-27a/Mapk14). The top five KEGG pathways enriched by Den-genes are Insulin signaling pathway, T cell receptor signaling pathway, MAPK signaling pathway, Toll-like receptor signaling pathway and B cell receptor signaling pathway. Our research has delineated the RNA regulatory network of denervated muscle atrophy, and uncovered the specific genes and terms in denervated muscle atrophy.
format	article
author	Xinyi Gu Bo Jin Zhidan Qi Xiaofeng Yin
author_facet	Xinyi Gu Bo Jin Zhidan Qi Xiaofeng Yin
author_sort	Xinyi Gu
title	Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis
title_short	Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis
title_full	Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis
title_fullStr	Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis
title_full_unstemmed	Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis
title_sort	identification of potential micrornas and kegg pathways in denervation muscle atrophy based on meta-analysis
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/93e2bd0f4a63432a9eec301b9229b057
work_keys_str_mv	AT xinyigu identificationofpotentialmicrornasandkeggpathwaysindenervationmuscleatrophybasedonmetaanalysis AT bojin identificationofpotentialmicrornasandkeggpathwaysindenervationmuscleatrophybasedonmetaanalysis AT zhidanqi identificationofpotentialmicrornasandkeggpathwaysindenervationmuscleatrophybasedonmetaanalysis AT xiaofengyin identificationofpotentialmicrornasandkeggpathwaysindenervationmuscleatrophybasedonmetaanalysis
_version_	1718383887678177280

Identification of potential microRNAs and KEGG pathways in denervation muscle atrophy based on meta-analysis

Ejemplares similares