Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway

Hong Liu,1,2 Yan-li Zhan,2,3 Guo-jing Luo,2,4 Ling-ling Zou,2,5 Yun Li,2 Hong-yun Lu2,4 1Department of Nutrition, The Third Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China; 2Department of Endocrinology & Metabolism, The Fifth Affiliated Hospi...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Liu H, Zhan Y, Luo G, Zou L, Li Y, Lu H
Formato:	article
Lenguaje:	EN
Publicado:	Dove Medical Press 2020
Materias:	liraglutide insulin human adipose derived stem cells obesity wnt signaling pathway Specialties of internal medicine RC581-951
Acceso en línea:	https://doaj.org/article/94756502d81b4d2d8abb54832354c67e
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:94756502d81b4d2d8abb54832354c67e
record_format	dspace
spelling	oai:doaj.org-article:94756502d81b4d2d8abb54832354c67e2021-12-02T12:33:46ZLiraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway1178-7007https://doaj.org/article/94756502d81b4d2d8abb54832354c67e2020-09-01T00:00:00Zhttps://www.dovepress.com/liraglutide-and-insulin-have-contrary-effects-on-adipogenesis-of-human-peer-reviewed-article-DMSOhttps://doaj.org/toc/1178-7007Hong Liu,1,2 Yan-li Zhan,2,3 Guo-jing Luo,2,4 Ling-ling Zou,2,5 Yun Li,2 Hong-yun Lu2,4 1Department of Nutrition, The Third Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China; 2Department of Endocrinology & Metabolism, The Fifth Affiliated Hospital of Sun Yat-Sen University, Zhuhai, Guangdong, People’s Republic of China; 3Department of Rheumatology, Jiaozuo People’s Hospital, Jiaozuo, Henan, People’s Republic of China; 4Department of Endocrinology & Metabolism, Zhuhai Hospital Affiliated with Jinan University, Zhuhai People’s Hospital, Zhuhai, Guangdong, People’s Republic of China; 5Department of Endocrinology, The Second People’s Hospital of Hefei, Anhui, People’s Republic of ChinaCorrespondence: Hong-yun LuDepartment of Endocrinology & Metabolism, The Fifth Affiliated Hospital of Sun Yat-Sen University, No. 52 Meihua East Road, Zhuhai, Guangdong 519000, People’s Republic of ChinaTel +86 756-252 8741Fax +86 75 6252 8300Email luhongy@mail.sysu.edu.cnBackground: Glucagon-like peptide-1 (GLP-1) has been reported to have beneficial impacts on improving human’s metabolism and ameliorating insulin resistance. While insulin is another important and conventional drug in diabetes treatment, but it has an adverse effect on weight gain.Purpose: To make sure whether GLP-1 and insulin play different roles in human adipose-derived stem cells (hADSCs).Methods: We examined the in vitro roles and molecular mechanisms of liraglutide, a GLP-1 analogue, and human insulin on hADSCs isolated from subcutaneous adipose tissue. Different concentrations (0, 0.1, 1, 10, 100nM) of liraglutide and insulin were added to proliferation and differentiation medium of hADSCs, respectively.Results: Liraglutide inhibits while insulin promotes the proliferation and differentiation at the concentration of 100nM. Moreover, the levels of GSK-3 increase during differentiation and liraglutide could down-regulate it when compared with insulin. We also find that the activation of phosphorylated GSK-3α and GSK-3β is involved in the differentiation roles. And classical and non-classical Wnt pathways all play roles in the differentiation, which are characterized with the up/down-regulation of the expression of adipogenesis genes such as PPAR-γ and CEBP-α.Conclusion: Liraglutide and insulin have contrary effects on the proliferation and adipogenesis via Wnt pathway in primary cultured ADSCs. Those effects could partly explain the different roles of GLP-1 and insulin on weight gain and insulin resistance.Keywords: liraglutide, insulin, human adipose-derived stem cells, obesity, Wnt signaling pathwayLiu HZhan YLuo GZou LLi YLu HDove Medical Pressarticleliraglutideinsulinhuman adipose derived stem cellsobesitywnt signaling pathwaySpecialties of internal medicineRC581-951ENDiabetes, Metabolic Syndrome and Obesity: Targets and Therapy, Vol Volume 13, Pp 3075-3087 (2020)
institution	DOAJ
collection	DOAJ
language	EN
topic	liraglutide insulin human adipose derived stem cells obesity wnt signaling pathway Specialties of internal medicine RC581-951
spellingShingle	liraglutide insulin human adipose derived stem cells obesity wnt signaling pathway Specialties of internal medicine RC581-951 Liu H Zhan Y Luo G Zou L Li Y Lu H Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway
description	Hong Liu,1,2 Yan-li Zhan,2,3 Guo-jing Luo,2,4 Ling-ling Zou,2,5 Yun Li,2 Hong-yun Lu2,4 1Department of Nutrition, The Third Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China; 2Department of Endocrinology & Metabolism, The Fifth Affiliated Hospital of Sun Yat-Sen University, Zhuhai, Guangdong, People’s Republic of China; 3Department of Rheumatology, Jiaozuo People’s Hospital, Jiaozuo, Henan, People’s Republic of China; 4Department of Endocrinology & Metabolism, Zhuhai Hospital Affiliated with Jinan University, Zhuhai People’s Hospital, Zhuhai, Guangdong, People’s Republic of China; 5Department of Endocrinology, The Second People’s Hospital of Hefei, Anhui, People’s Republic of ChinaCorrespondence: Hong-yun LuDepartment of Endocrinology & Metabolism, The Fifth Affiliated Hospital of Sun Yat-Sen University, No. 52 Meihua East Road, Zhuhai, Guangdong 519000, People’s Republic of ChinaTel +86 756-252 8741Fax +86 75 6252 8300Email luhongy@mail.sysu.edu.cnBackground: Glucagon-like peptide-1 (GLP-1) has been reported to have beneficial impacts on improving human’s metabolism and ameliorating insulin resistance. While insulin is another important and conventional drug in diabetes treatment, but it has an adverse effect on weight gain.Purpose: To make sure whether GLP-1 and insulin play different roles in human adipose-derived stem cells (hADSCs).Methods: We examined the in vitro roles and molecular mechanisms of liraglutide, a GLP-1 analogue, and human insulin on hADSCs isolated from subcutaneous adipose tissue. Different concentrations (0, 0.1, 1, 10, 100nM) of liraglutide and insulin were added to proliferation and differentiation medium of hADSCs, respectively.Results: Liraglutide inhibits while insulin promotes the proliferation and differentiation at the concentration of 100nM. Moreover, the levels of GSK-3 increase during differentiation and liraglutide could down-regulate it when compared with insulin. We also find that the activation of phosphorylated GSK-3α and GSK-3β is involved in the differentiation roles. And classical and non-classical Wnt pathways all play roles in the differentiation, which are characterized with the up/down-regulation of the expression of adipogenesis genes such as PPAR-γ and CEBP-α.Conclusion: Liraglutide and insulin have contrary effects on the proliferation and adipogenesis via Wnt pathway in primary cultured ADSCs. Those effects could partly explain the different roles of GLP-1 and insulin on weight gain and insulin resistance.Keywords: liraglutide, insulin, human adipose-derived stem cells, obesity, Wnt signaling pathway
format	article
author	Liu H Zhan Y Luo G Zou L Li Y Lu H
author_facet	Liu H Zhan Y Luo G Zou L Li Y Lu H
author_sort	Liu H
title	Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway
title_short	Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway
title_full	Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway
title_fullStr	Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway
title_full_unstemmed	Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway
title_sort	liraglutide and insulin have contrary effects on adipogenesis of human adipose-derived stem cells via wnt pathway
publisher	Dove Medical Press
publishDate	2020
url	https://doaj.org/article/94756502d81b4d2d8abb54832354c67e
work_keys_str_mv	AT liuh liraglutideandinsulinhavecontraryeffectsonadipogenesisofhumanadiposederivedstemcellsviawntpathway AT zhany liraglutideandinsulinhavecontraryeffectsonadipogenesisofhumanadiposederivedstemcellsviawntpathway AT luog liraglutideandinsulinhavecontraryeffectsonadipogenesisofhumanadiposederivedstemcellsviawntpathway AT zoul liraglutideandinsulinhavecontraryeffectsonadipogenesisofhumanadiposederivedstemcellsviawntpathway AT liy liraglutideandinsulinhavecontraryeffectsonadipogenesisofhumanadiposederivedstemcellsviawntpathway AT luh liraglutideandinsulinhavecontraryeffectsonadipogenesisofhumanadiposederivedstemcellsviawntpathway
_version_	1718393873558929408

Liraglutide and Insulin Have Contrary Effects on Adipogenesis of Human Adipose-Derived Stem Cells via Wnt Pathway

Ejemplares similares