A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae
Abstract Although many putative long non-coding RNA (lncRNA) genes have been identified in insect genomes, few of these genes have been functionally validated. A screen for female-specific larvicides that facilitate Aedes aegypti male sex separation uncovered multiple interfering RNAs with target si...
Guardado en:
Autores principales: | , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Nature Portfolio
2021
|
Materias: | |
Acceso en línea: | https://doaj.org/article/a261c85d9dac4d6cbf553474beadabb1 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:a261c85d9dac4d6cbf553474beadabb1 |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:a261c85d9dac4d6cbf553474beadabb12021-12-02T15:53:01ZA functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae10.1038/s41598-021-90194-72045-2322https://doaj.org/article/a261c85d9dac4d6cbf553474beadabb12021-05-01T00:00:00Zhttps://doi.org/10.1038/s41598-021-90194-7https://doaj.org/toc/2045-2322Abstract Although many putative long non-coding RNA (lncRNA) genes have been identified in insect genomes, few of these genes have been functionally validated. A screen for female-specific larvicides that facilitate Aedes aegypti male sex separation uncovered multiple interfering RNAs with target sites in lncRNA genes located in the M/m locus region, including loci within or tightly linked to the sex determination locus. Larval consumption of a Saccharomyces cerevisiae (yeast) strain engineered to express interfering RNA corresponding to lncRNA transcripts resulted in significant female death, yet had no impact on male survival or fitness. Incorporation of the yeast larvicides into mass culturing protocols facilitated scaled production and separation of fit adult males, indicating that yeast larvicides could benefit mosquito population control strategies that rely on mass releases of male mosquitoes. These studies functionally verified a female-specific developmental requirement for M/m locus region lncRNA genes, suggesting that sexually antagonistic lncRNA genes found within this highly repetitive pericentromeric DNA sequence may be contributing to the evolution of A. aegypti sex chromosomes.Keshava MysoreLimb K. HapairaiPing LiJoseph B. RoetheleLonghua SunJessica IgiedeJoi K. MisentiMolly Duman-ScheelNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 11, Iss 1, Pp 1-10 (2021) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Keshava Mysore Limb K. Hapairai Ping Li Joseph B. Roethele Longhua Sun Jessica Igiede Joi K. Misenti Molly Duman-Scheel A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae |
description |
Abstract Although many putative long non-coding RNA (lncRNA) genes have been identified in insect genomes, few of these genes have been functionally validated. A screen for female-specific larvicides that facilitate Aedes aegypti male sex separation uncovered multiple interfering RNAs with target sites in lncRNA genes located in the M/m locus region, including loci within or tightly linked to the sex determination locus. Larval consumption of a Saccharomyces cerevisiae (yeast) strain engineered to express interfering RNA corresponding to lncRNA transcripts resulted in significant female death, yet had no impact on male survival or fitness. Incorporation of the yeast larvicides into mass culturing protocols facilitated scaled production and separation of fit adult males, indicating that yeast larvicides could benefit mosquito population control strategies that rely on mass releases of male mosquitoes. These studies functionally verified a female-specific developmental requirement for M/m locus region lncRNA genes, suggesting that sexually antagonistic lncRNA genes found within this highly repetitive pericentromeric DNA sequence may be contributing to the evolution of A. aegypti sex chromosomes. |
format |
article |
author |
Keshava Mysore Limb K. Hapairai Ping Li Joseph B. Roethele Longhua Sun Jessica Igiede Joi K. Misenti Molly Duman-Scheel |
author_facet |
Keshava Mysore Limb K. Hapairai Ping Li Joseph B. Roethele Longhua Sun Jessica Igiede Joi K. Misenti Molly Duman-Scheel |
author_sort |
Keshava Mysore |
title |
A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae |
title_short |
A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae |
title_full |
A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae |
title_fullStr |
A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae |
title_full_unstemmed |
A functional requirement for sex-determination M/m locus region lncRNA genes in Aedes aegypti female larvae |
title_sort |
functional requirement for sex-determination m/m locus region lncrna genes in aedes aegypti female larvae |
publisher |
Nature Portfolio |
publishDate |
2021 |
url |
https://doaj.org/article/a261c85d9dac4d6cbf553474beadabb1 |
work_keys_str_mv |
AT keshavamysore afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT limbkhapairai afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT pingli afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT josephbroethele afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT longhuasun afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT jessicaigiede afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT joikmisenti afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT mollydumanscheel afunctionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT keshavamysore functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT limbkhapairai functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT pingli functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT josephbroethele functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT longhuasun functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT jessicaigiede functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT joikmisenti functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae AT mollydumanscheel functionalrequirementforsexdeterminationmmlocusregionlncrnagenesinaedesaegyptifemalelarvae |
_version_ |
1718385527480123392 |