Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis.
<h4>Objectives</h4>To investigate the suggested role of Porphyromonas gingivalis peptidylarginine deiminase (PAD) in the relationship between the aetiology of periodontal disease and experimentally induced arthritis and the possible association between these two conditions.<h4>Meth...
Guardado en:
Autores principales: | , , , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Public Library of Science (PLoS)
2014
|
Materias: | |
Acceso en línea: | https://doaj.org/article/ac9b3d852786439280ad018a9924e818 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:ac9b3d852786439280ad018a9924e818 |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:ac9b3d852786439280ad018a9924e8182021-11-11T08:21:54ZPorphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis.1932-620310.1371/journal.pone.0100838https://doaj.org/article/ac9b3d852786439280ad018a9924e8182014-01-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/pmid/24959715/pdf/?tool=EBIhttps://doaj.org/toc/1932-6203<h4>Objectives</h4>To investigate the suggested role of Porphyromonas gingivalis peptidylarginine deiminase (PAD) in the relationship between the aetiology of periodontal disease and experimentally induced arthritis and the possible association between these two conditions.<h4>Methods</h4>A genetically modified PAD-deficient strain of P. gingivalis W50 was produced. The effect of this strain, compared to the wild type, in an established murine model for experimental periodontitis and experimental arthritis was assessed. Experimental periodontitis was induced following oral inoculation with the PAD-deficient and wild type strains of P. gingivalis. Experimental arthritis was induced via the collagen antibody induction process and was monitored by assessment of paw swelling and micro-CT analysis of the radio-carpal joints. Experimental periodontitis was monitored by micro CT scans of the mandible and histological assessment of the periodontal tissues around the mandibular molars. Serum levels of anti-citrullinated protein antibodies (ACPA) and P. gingivalis were assessed by ELISA.<h4>Results</h4>The development of experimental periodontitis was significantly reduced in the presence of the PAD-deficient P. gingivalis strain. When experimental arthritis was induced in the presence of the PAD-deficient strain there was less paw swelling, less erosive bone damage to the joints and reduced serum ACPA levels when compared to the wild type P. gingivalis inoculated group.<h4>Conclusion</h4>This study has demonstrated that a PAD-deficient strain of P. gingivalis was associated with significantly reduced periodontal inflammation. In addition the extent of experimental arthritis was significantly reduced in animals exposed to prior induction of periodontal disease through oral inoculation of the PAD-deficient strain versus the wild type. This adds further evidence to the potential role for P. gingivalis and its PAD in the pathogenesis of periodontitis and exacerbation of arthritis. Further studies are now needed to elucidate the mechanisms which drive these processes.Neville GullyRichard BrightVictor MarinoCeilidh MarchantMelissa CantleyDavid HaynesCatherine ButlerStuart DashperEric ReynoldsMark BartoldPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 9, Iss 6, p e100838 (2014) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Neville Gully Richard Bright Victor Marino Ceilidh Marchant Melissa Cantley David Haynes Catherine Butler Stuart Dashper Eric Reynolds Mark Bartold Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
description |
<h4>Objectives</h4>To investigate the suggested role of Porphyromonas gingivalis peptidylarginine deiminase (PAD) in the relationship between the aetiology of periodontal disease and experimentally induced arthritis and the possible association between these two conditions.<h4>Methods</h4>A genetically modified PAD-deficient strain of P. gingivalis W50 was produced. The effect of this strain, compared to the wild type, in an established murine model for experimental periodontitis and experimental arthritis was assessed. Experimental periodontitis was induced following oral inoculation with the PAD-deficient and wild type strains of P. gingivalis. Experimental arthritis was induced via the collagen antibody induction process and was monitored by assessment of paw swelling and micro-CT analysis of the radio-carpal joints. Experimental periodontitis was monitored by micro CT scans of the mandible and histological assessment of the periodontal tissues around the mandibular molars. Serum levels of anti-citrullinated protein antibodies (ACPA) and P. gingivalis were assessed by ELISA.<h4>Results</h4>The development of experimental periodontitis was significantly reduced in the presence of the PAD-deficient P. gingivalis strain. When experimental arthritis was induced in the presence of the PAD-deficient strain there was less paw swelling, less erosive bone damage to the joints and reduced serum ACPA levels when compared to the wild type P. gingivalis inoculated group.<h4>Conclusion</h4>This study has demonstrated that a PAD-deficient strain of P. gingivalis was associated with significantly reduced periodontal inflammation. In addition the extent of experimental arthritis was significantly reduced in animals exposed to prior induction of periodontal disease through oral inoculation of the PAD-deficient strain versus the wild type. This adds further evidence to the potential role for P. gingivalis and its PAD in the pathogenesis of periodontitis and exacerbation of arthritis. Further studies are now needed to elucidate the mechanisms which drive these processes. |
format |
article |
author |
Neville Gully Richard Bright Victor Marino Ceilidh Marchant Melissa Cantley David Haynes Catherine Butler Stuart Dashper Eric Reynolds Mark Bartold |
author_facet |
Neville Gully Richard Bright Victor Marino Ceilidh Marchant Melissa Cantley David Haynes Catherine Butler Stuart Dashper Eric Reynolds Mark Bartold |
author_sort |
Neville Gully |
title |
Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
title_short |
Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
title_full |
Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
title_fullStr |
Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
title_full_unstemmed |
Porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
title_sort |
porphyromonas gingivalis peptidylarginine deiminase, a key contributor in the pathogenesis of experimental periodontal disease and experimental arthritis. |
publisher |
Public Library of Science (PLoS) |
publishDate |
2014 |
url |
https://doaj.org/article/ac9b3d852786439280ad018a9924e818 |
work_keys_str_mv |
AT nevillegully porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT richardbright porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT victormarino porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT ceilidhmarchant porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT melissacantley porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT davidhaynes porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT catherinebutler porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT stuartdashper porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT ericreynolds porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis AT markbartold porphyromonasgingivalispeptidylargininedeiminaseakeycontributorinthepathogenesisofexperimentalperiodontaldiseaseandexperimentalarthritis |
_version_ |
1718439339853086720 |