Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes

A diverse array of antigens can trigger allergic reactions. Here the authors present the ‘AllerScan’ programmable phage display library, which is an efficient and unbiased approach for profiling anti-allergen antibody reactivities at cohort scale, with which a key wheat epitope is found to distingui...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Daniel R. Monaco, Brandon M. Sie, Thomas R. Nirschl, Audrey C. Knight, Hugh A. Sampson, Anna Nowak-Wegrzyn, Robert A. Wood, Robert G. Hamilton, Pamela A. Frischmeyer-Guerrerio, H. Benjamin Larman
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Science Q
Acceso en línea:	https://doaj.org/article/b8e61b941a1b437c95176c991f1acd7e
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:b8e61b941a1b437c95176c991f1acd7e
record_format	dspace
spelling	oai:doaj.org-article:b8e61b941a1b437c95176c991f1acd7e2021-12-02T14:08:59ZProfiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes10.1038/s41467-020-20622-12041-1723https://doaj.org/article/b8e61b941a1b437c95176c991f1acd7e2021-01-01T00:00:00Zhttps://doi.org/10.1038/s41467-020-20622-1https://doaj.org/toc/2041-1723A diverse array of antigens can trigger allergic reactions. Here the authors present the ‘AllerScan’ programmable phage display library, which is an efficient and unbiased approach for profiling anti-allergen antibody reactivities at cohort scale, with which a key wheat epitope is found to distinguish between wheat allergy and tolerance.Daniel R. MonacoBrandon M. SieThomas R. NirschlAudrey C. KnightHugh A. SampsonAnna Nowak-WegrzynRobert A. WoodRobert G. HamiltonPamela A. Frischmeyer-GuerrerioH. Benjamin LarmanNature PortfolioarticleScienceQENNature Communications, Vol 12, Iss 1, Pp 1-10 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Science Q
spellingShingle	Science Q Daniel R. Monaco Brandon M. Sie Thomas R. Nirschl Audrey C. Knight Hugh A. Sampson Anna Nowak-Wegrzyn Robert A. Wood Robert G. Hamilton Pamela A. Frischmeyer-Guerrerio H. Benjamin Larman Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
description	A diverse array of antigens can trigger allergic reactions. Here the authors present the ‘AllerScan’ programmable phage display library, which is an efficient and unbiased approach for profiling anti-allergen antibody reactivities at cohort scale, with which a key wheat epitope is found to distinguish between wheat allergy and tolerance.
format	article
author	Daniel R. Monaco Brandon M. Sie Thomas R. Nirschl Audrey C. Knight Hugh A. Sampson Anna Nowak-Wegrzyn Robert A. Wood Robert G. Hamilton Pamela A. Frischmeyer-Guerrerio H. Benjamin Larman
author_facet	Daniel R. Monaco Brandon M. Sie Thomas R. Nirschl Audrey C. Knight Hugh A. Sampson Anna Nowak-Wegrzyn Robert A. Wood Robert G. Hamilton Pamela A. Frischmeyer-Guerrerio H. Benjamin Larman
author_sort	Daniel R. Monaco
title	Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_short	Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_full	Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_fullStr	Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_full_unstemmed	Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
title_sort	profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/b8e61b941a1b437c95176c991f1acd7e
work_keys_str_mv	AT danielrmonaco profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT brandonmsie profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT thomasrnirschl profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT audreycknight profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT hughasampson profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT annanowakwegrzyn profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT robertawood profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT robertghamilton profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT pamelaafrischmeyerguerrerio profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes AT hbenjaminlarman profilingserumantibodieswithapanallergenphagelibraryidentifieskeywheatallergyepitopes
_version_	1718391928161042432

Profiling serum antibodies with a pan allergen phage library identifies key wheat allergy epitopes

Ejemplares similares