Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit

Kiwifruit bacterial canker caused by Pseudomonas syringae pv. actinidiae (Psa), is an important disease of kiwifruit (Actinidia Lind.). Plant hormones may induce various secondary metabolites to resist pathogens via modulation of hormone-responsive transcription factors (TFs), as reported in past st...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Xiaojie Wang, Yawei Li, Yuanyuan Liu, Dongle Zhang, Min Ni, Bing Jia, Wei Heng, Zemin Fang, Li-wu Zhu, Pu Liu
Formato:	article
Lenguaje:	EN
Publicado:	Frontiers Media S.A. 2021
Materias:	Actinidia chinensis var. deliciosa bacterial canker proteome transcriptome MYB TFs Plant culture SB1-1110
Acceso en línea:	https://doaj.org/article/b97cf2d903e04837b818d43182ee8375
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:b97cf2d903e04837b818d43182ee8375
record_format	dspace
spelling	oai:doaj.org-article:b97cf2d903e04837b818d43182ee83752021-11-11T13:17:20ZTranscriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit1664-462X10.3389/fpls.2021.756330https://doaj.org/article/b97cf2d903e04837b818d43182ee83752021-11-01T00:00:00Zhttps://www.frontiersin.org/articles/10.3389/fpls.2021.756330/fullhttps://doaj.org/toc/1664-462XKiwifruit bacterial canker caused by Pseudomonas syringae pv. actinidiae (Psa), is an important disease of kiwifruit (Actinidia Lind.). Plant hormones may induce various secondary metabolites to resist pathogens via modulation of hormone-responsive transcription factors (TFs), as reported in past studies. In this study, we showed that JA accumulated in the susceptible cultivar Actinidia chinensis ‘Hongyang’ but decreased in the resistant cultivar of A. chinensis var. deliciosa ‘Jinkui’ in response to Psa. Integrated transcriptomic and proteomic analyses were carried out using the resistant cultivar ‘Jinkui’. A total of 5,045 differentially expressed genes (DEGs) and 1,681 differentially expressed proteins (DEPs) were identified after Psa infection. Two pathways, ‘plant hormone signal transduction’ and ‘phenylpropanoid biosynthesis,’ were activated at the protein and transcript levels. In addition, a total of 27 R2R3-MYB transcription factors (TFs) were involved in the response to Psa of ‘Jinkui,’ including the R2R3-MYB TF subgroup 4 gene AcMYB16, which was downregulated in ‘Jinkui’ but upregulated in ‘Hongyang.’ The promoter region of AcMYB16 has a MeJA responsiveness cis-acting regulatory element (CRE). Transient expression of the AcMYB16 gene in the leaves of ‘Jinkui’ induced Psa infection. Together, these data suggest that AcMYB16 acts as a repressor to regulate the response of kiwifruit to Psa infection. Our work will help to unravel the processes of kiwifruit resistance to pathogens and will facilitate the development of varieties with resistance against bacterial pathogens.Xiaojie WangXiaojie WangYawei LiYuanyuan LiuDongle ZhangMin NiBing JiaWei HengZemin FangLi-wu ZhuPu LiuFrontiers Media S.A.articleActinidia chinensis var. deliciosabacterial cankerproteometranscriptomeMYB TFsPlant cultureSB1-1110ENFrontiers in Plant Science, Vol 12 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Actinidia chinensis var. deliciosa bacterial canker proteome transcriptome MYB TFs Plant culture SB1-1110
spellingShingle	Actinidia chinensis var. deliciosa bacterial canker proteome transcriptome MYB TFs Plant culture SB1-1110 Xiaojie Wang Xiaojie Wang Yawei Li Yuanyuan Liu Dongle Zhang Min Ni Bing Jia Wei Heng Zemin Fang Li-wu Zhu Pu Liu Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit
description	Kiwifruit bacterial canker caused by Pseudomonas syringae pv. actinidiae (Psa), is an important disease of kiwifruit (Actinidia Lind.). Plant hormones may induce various secondary metabolites to resist pathogens via modulation of hormone-responsive transcription factors (TFs), as reported in past studies. In this study, we showed that JA accumulated in the susceptible cultivar Actinidia chinensis ‘Hongyang’ but decreased in the resistant cultivar of A. chinensis var. deliciosa ‘Jinkui’ in response to Psa. Integrated transcriptomic and proteomic analyses were carried out using the resistant cultivar ‘Jinkui’. A total of 5,045 differentially expressed genes (DEGs) and 1,681 differentially expressed proteins (DEPs) were identified after Psa infection. Two pathways, ‘plant hormone signal transduction’ and ‘phenylpropanoid biosynthesis,’ were activated at the protein and transcript levels. In addition, a total of 27 R2R3-MYB transcription factors (TFs) were involved in the response to Psa of ‘Jinkui,’ including the R2R3-MYB TF subgroup 4 gene AcMYB16, which was downregulated in ‘Jinkui’ but upregulated in ‘Hongyang.’ The promoter region of AcMYB16 has a MeJA responsiveness cis-acting regulatory element (CRE). Transient expression of the AcMYB16 gene in the leaves of ‘Jinkui’ induced Psa infection. Together, these data suggest that AcMYB16 acts as a repressor to regulate the response of kiwifruit to Psa infection. Our work will help to unravel the processes of kiwifruit resistance to pathogens and will facilitate the development of varieties with resistance against bacterial pathogens.
format	article
author	Xiaojie Wang Xiaojie Wang Yawei Li Yuanyuan Liu Dongle Zhang Min Ni Bing Jia Wei Heng Zemin Fang Li-wu Zhu Pu Liu
author_facet	Xiaojie Wang Xiaojie Wang Yawei Li Yuanyuan Liu Dongle Zhang Min Ni Bing Jia Wei Heng Zemin Fang Li-wu Zhu Pu Liu
author_sort	Xiaojie Wang
title	Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit
title_short	Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit
title_full	Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit
title_fullStr	Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit
title_full_unstemmed	Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit
title_sort	transcriptomic and proteomic profiling reveal the key role of acmyb16 in the response of pseudomonas syringae pv. actinidiae in kiwifruit
publisher	Frontiers Media S.A.
publishDate	2021
url	https://doaj.org/article/b97cf2d903e04837b818d43182ee8375
work_keys_str_mv	AT xiaojiewang transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT xiaojiewang transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT yaweili transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT yuanyuanliu transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT donglezhang transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT minni transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT bingjia transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT weiheng transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT zeminfang transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT liwuzhu transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit AT puliu transcriptomicandproteomicprofilingrevealthekeyroleofacmyb16intheresponseofpseudomonassyringaepvactinidiaeinkiwifruit
_version_	1718439071782535168

Transcriptomic and Proteomic Profiling Reveal the Key Role of AcMYB16 in the Response of Pseudomonas syringae pv. actinidiae in Kiwifruit

Ejemplares similares