Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease

To investigate the effects of chronic hyperglycemia on hippocampal network activity Wirt et al induced sustained hyperglycemia in rats and tested them in a spatial delayed alternation task while recording from the hippocampus and anterior cingulate cortex. They demonstrated that hyperglycemia impair...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Ryan. A. Wirt, Lauren. A. Crew, Andrew. A. Ortiz, Adam. M. McNeela, Emmanuel Flores, Jefferson. W. Kinney, James M. Hyman
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2021
Materias:	Biology (General) QH301-705.5
Acceso en línea:	https://doaj.org/article/ba44439da3804d76a8fab5796ca4c4fe
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:ba44439da3804d76a8fab5796ca4c4fe
record_format	dspace
spelling	oai:doaj.org-article:ba44439da3804d76a8fab5796ca4c4fe2021-12-02T19:04:11ZAltered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease10.1038/s42003-021-02558-42399-3642https://doaj.org/article/ba44439da3804d76a8fab5796ca4c4fe2021-09-01T00:00:00Zhttps://doi.org/10.1038/s42003-021-02558-4https://doaj.org/toc/2399-3642To investigate the effects of chronic hyperglycemia on hippocampal network activity Wirt et al induced sustained hyperglycemia in rats and tested them in a spatial delayed alternation task while recording from the hippocampus and anterior cingulate cortex. They demonstrated that hyperglycemia impaired task performance and altered theta rhythm as well as increasing tau phosphorylation, which suggest there is potentially a direct link between chronic hyperglycemia and Alzheimer’s disease.Ryan. A. WirtLauren. A. CrewAndrew. A. OrtizAdam. M. McNeelaEmmanuel FloresJefferson. W. KinneyJames M. HymanNature PortfolioarticleBiology (General)QH301-705.5ENCommunications Biology, Vol 4, Iss 1, Pp 1-16 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Biology (General) QH301-705.5
spellingShingle	Biology (General) QH301-705.5 Ryan. A. Wirt Lauren. A. Crew Andrew. A. Ortiz Adam. M. McNeela Emmanuel Flores Jefferson. W. Kinney James M. Hyman Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease
description	To investigate the effects of chronic hyperglycemia on hippocampal network activity Wirt et al induced sustained hyperglycemia in rats and tested them in a spatial delayed alternation task while recording from the hippocampus and anterior cingulate cortex. They demonstrated that hyperglycemia impaired task performance and altered theta rhythm as well as increasing tau phosphorylation, which suggest there is potentially a direct link between chronic hyperglycemia and Alzheimer’s disease.
format	article
author	Ryan. A. Wirt Lauren. A. Crew Andrew. A. Ortiz Adam. M. McNeela Emmanuel Flores Jefferson. W. Kinney James M. Hyman
author_facet	Ryan. A. Wirt Lauren. A. Crew Andrew. A. Ortiz Adam. M. McNeela Emmanuel Flores Jefferson. W. Kinney James M. Hyman
author_sort	Ryan. A. Wirt
title	Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease
title_short	Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease
title_full	Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease
title_fullStr	Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease
title_full_unstemmed	Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease
title_sort	altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of alzheimer’s disease
publisher	Nature Portfolio
publishDate	2021
url	https://doaj.org/article/ba44439da3804d76a8fab5796ca4c4fe
work_keys_str_mv	AT ryanawirt alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease AT laurenacrew alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease AT andrewaortiz alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease AT adammmcneela alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease AT emmanuelflores alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease AT jeffersonwkinney alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease AT jamesmhyman alteredthetarhythmandhippocampalcorticalinteractionsunderlieworkingmemorydeficitsinahyperglycemiariskfactormodelofalzheimersdisease
_version_	1718377233471504384

Altered theta rhythm and hippocampal-cortical interactions underlie working memory deficits in a hyperglycemia risk factor model of Alzheimer’s disease

Ejemplares similares