Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification

When trialkylamines are added to buffered solutions of peptides, unexpected adducts can be formed. These adducts correspond to Schiff base products. The source of the reaction is the unexpected presence of aldehydes in amines. The aldehydes can be detected in a few ways. Most importantly, they can l...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Yiran Ma, Puja J. Gandhi, James P. Reilly
Formato:	article
Lenguaje:	EN
Publicado:	MDPI AG 2021
Materias:	triethylamine Schiff base protein modification Organic chemistry QD241-441
Acceso en línea:	https://doaj.org/article/bbcdd9675f0444dd82e01da2303b16c7
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:bbcdd9675f0444dd82e01da2303b16c7
record_format	dspace
spelling	oai:doaj.org-article:bbcdd9675f0444dd82e01da2303b16c72021-11-11T18:29:14ZAqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification10.3390/molecules262164811420-3049https://doaj.org/article/bbcdd9675f0444dd82e01da2303b16c72021-10-01T00:00:00Zhttps://www.mdpi.com/1420-3049/26/21/6481https://doaj.org/toc/1420-3049When trialkylamines are added to buffered solutions of peptides, unexpected adducts can be formed. These adducts correspond to Schiff base products. The source of the reaction is the unexpected presence of aldehydes in amines. The aldehydes can be detected in a few ways. Most importantly, they can lead to unanticipated results in proteomics experiments. Their undesirable effects can be minimized through the addition of other amines.Yiran MaPuja J. GandhiJames P. ReillyMDPI AGarticletriethylamineSchiff baseprotein modificationOrganic chemistryQD241-441ENMolecules, Vol 26, Iss 6481, p 6481 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	triethylamine Schiff base protein modification Organic chemistry QD241-441
spellingShingle	triethylamine Schiff base protein modification Organic chemistry QD241-441 Yiran Ma Puja J. Gandhi James P. Reilly Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
description	When trialkylamines are added to buffered solutions of peptides, unexpected adducts can be formed. These adducts correspond to Schiff base products. The source of the reaction is the unexpected presence of aldehydes in amines. The aldehydes can be detected in a few ways. Most importantly, they can lead to unanticipated results in proteomics experiments. Their undesirable effects can be minimized through the addition of other amines.
format	article
author	Yiran Ma Puja J. Gandhi James P. Reilly
author_facet	Yiran Ma Puja J. Gandhi James P. Reilly
author_sort	Yiran Ma
title	Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_short	Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_full	Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_fullStr	Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_full_unstemmed	Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification
title_sort	aqueous solutions of peptides and trialkylamines lead to unexpected peptide modification
publisher	MDPI AG
publishDate	2021
url	https://doaj.org/article/bbcdd9675f0444dd82e01da2303b16c7
work_keys_str_mv	AT yiranma aqueoussolutionsofpeptidesandtrialkylaminesleadtounexpectedpeptidemodification AT pujajgandhi aqueoussolutionsofpeptidesandtrialkylaminesleadtounexpectedpeptidemodification AT jamespreilly aqueoussolutionsofpeptidesandtrialkylaminesleadtounexpectedpeptidemodification
_version_	1718431847440973824

Aqueous Solutions of Peptides and Trialkylamines Lead to Unexpected Peptide Modification

Ejemplares similares