Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
Abstract Recombinant TWIK2 channels produce weak basal background K+ currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking....
Guardado en:
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Nature Portfolio
2017
|
Materias: | |
Acceso en línea: | https://doaj.org/article/c08363747f7a45328c794c87466f64ca |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:c08363747f7a45328c794c87466f64ca |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:c08363747f7a45328c794c87466f64ca2021-12-02T16:07:44ZRecombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels10.1038/s41598-017-00640-82045-2322https://doaj.org/article/c08363747f7a45328c794c87466f64ca2017-04-01T00:00:00Zhttps://doi.org/10.1038/s41598-017-00640-8https://doaj.org/toc/2045-2322Abstract Recombinant TWIK2 channels produce weak basal background K+ currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We identified three different sequence signals responsible for the preferential expression of TWIK2 in the Lamp1-positive lysosomal compartment. Sequential inactivation of tyrosine-based (Y308ASIP) and di-leucine-like (E266LILL and D282EDDQVDIL) trafficking motifs progressively abolishes the targeting of TWIK2 to lysosomes, and promotes its functional relocation at the plasma membrane. In addition, TWIK2 contains two N-glycosylation sites (N79AS and N85AS) on its luminal side, and glycosylation is necessary for expression in lysosomes. As shown by electrophysiology and electron microscopy, TWIK2 produces functional background K+ currents in the endolysosomes, and its expression affects the number and mean size of the lysosomes. These results show that TWIK2 is expressed in lysosomes, further expanding the registry of ion channels expressed in these organelles.Nicole BobakSylvain FeliciangeliCheng-Chang ChenIsmail Ben SoussiaStefan BittnerSophie PagnottaTobias RuckMartin BielChristian Wahl-SchottChristian GrimmSven G. MeuthFlorian LesageNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 7, Iss 1, Pp 1-13 (2017) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Nicole Bobak Sylvain Feliciangeli Cheng-Chang Chen Ismail Ben Soussia Stefan Bittner Sophie Pagnotta Tobias Ruck Martin Biel Christian Wahl-Schott Christian Grimm Sven G. Meuth Florian Lesage Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels |
description |
Abstract Recombinant TWIK2 channels produce weak basal background K+ currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We identified three different sequence signals responsible for the preferential expression of TWIK2 in the Lamp1-positive lysosomal compartment. Sequential inactivation of tyrosine-based (Y308ASIP) and di-leucine-like (E266LILL and D282EDDQVDIL) trafficking motifs progressively abolishes the targeting of TWIK2 to lysosomes, and promotes its functional relocation at the plasma membrane. In addition, TWIK2 contains two N-glycosylation sites (N79AS and N85AS) on its luminal side, and glycosylation is necessary for expression in lysosomes. As shown by electrophysiology and electron microscopy, TWIK2 produces functional background K+ currents in the endolysosomes, and its expression affects the number and mean size of the lysosomes. These results show that TWIK2 is expressed in lysosomes, further expanding the registry of ion channels expressed in these organelles. |
format |
article |
author |
Nicole Bobak Sylvain Feliciangeli Cheng-Chang Chen Ismail Ben Soussia Stefan Bittner Sophie Pagnotta Tobias Ruck Martin Biel Christian Wahl-Schott Christian Grimm Sven G. Meuth Florian Lesage |
author_facet |
Nicole Bobak Sylvain Feliciangeli Cheng-Chang Chen Ismail Ben Soussia Stefan Bittner Sophie Pagnotta Tobias Ruck Martin Biel Christian Wahl-Schott Christian Grimm Sven G. Meuth Florian Lesage |
author_sort |
Nicole Bobak |
title |
Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels |
title_short |
Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels |
title_full |
Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels |
title_fullStr |
Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels |
title_full_unstemmed |
Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels |
title_sort |
recombinant tandem of pore-domains in a weakly inward rectifying k+ channel 2 (twik2) forms active lysosomal channels |
publisher |
Nature Portfolio |
publishDate |
2017 |
url |
https://doaj.org/article/c08363747f7a45328c794c87466f64ca |
work_keys_str_mv |
AT nicolebobak recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT sylvainfeliciangeli recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT chengchangchen recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT ismailbensoussia recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT stefanbittner recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT sophiepagnotta recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT tobiasruck recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT martinbiel recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT christianwahlschott recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT christiangrimm recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT svengmeuth recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels AT florianlesage recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels |
_version_ |
1718384742822313984 |