Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels

Abstract Recombinant TWIK2 channels produce weak basal background K+ currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking....

Descripción completa

Guardado en:
Detalles Bibliográficos
Autores principales: Nicole Bobak, Sylvain Feliciangeli, Cheng-Chang Chen, Ismail Ben Soussia, Stefan Bittner, Sophie Pagnotta, Tobias Ruck, Martin Biel, Christian Wahl-Schott, Christian Grimm, Sven G. Meuth, Florian Lesage
Formato: article
Lenguaje:EN
Publicado: Nature Portfolio 2017
Materias:
R
Q
Acceso en línea:https://doaj.org/article/c08363747f7a45328c794c87466f64ca
Etiquetas: Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
id oai:doaj.org-article:c08363747f7a45328c794c87466f64ca
record_format dspace
spelling oai:doaj.org-article:c08363747f7a45328c794c87466f64ca2021-12-02T16:07:44ZRecombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels10.1038/s41598-017-00640-82045-2322https://doaj.org/article/c08363747f7a45328c794c87466f64ca2017-04-01T00:00:00Zhttps://doi.org/10.1038/s41598-017-00640-8https://doaj.org/toc/2045-2322Abstract Recombinant TWIK2 channels produce weak basal background K+ currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We identified three different sequence signals responsible for the preferential expression of TWIK2 in the Lamp1-positive lysosomal compartment. Sequential inactivation of tyrosine-based (Y308ASIP) and di-leucine-like (E266LILL and D282EDDQVDIL) trafficking motifs progressively abolishes the targeting of TWIK2 to lysosomes, and promotes its functional relocation at the plasma membrane. In addition, TWIK2 contains two N-glycosylation sites (N79AS and N85AS) on its luminal side, and glycosylation is necessary for expression in lysosomes. As shown by electrophysiology and electron microscopy, TWIK2 produces functional background K+ currents in the endolysosomes, and its expression affects the number and mean size of the lysosomes. These results show that TWIK2 is expressed in lysosomes, further expanding the registry of ion channels expressed in these organelles.Nicole BobakSylvain FeliciangeliCheng-Chang ChenIsmail Ben SoussiaStefan BittnerSophie PagnottaTobias RuckMartin BielChristian Wahl-SchottChristian GrimmSven G. MeuthFlorian LesageNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 7, Iss 1, Pp 1-13 (2017)
institution DOAJ
collection DOAJ
language EN
topic Medicine
R
Science
Q
spellingShingle Medicine
R
Science
Q
Nicole Bobak
Sylvain Feliciangeli
Cheng-Chang Chen
Ismail Ben Soussia
Stefan Bittner
Sophie Pagnotta
Tobias Ruck
Martin Biel
Christian Wahl-Schott
Christian Grimm
Sven G. Meuth
Florian Lesage
Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
description Abstract Recombinant TWIK2 channels produce weak basal background K+ currents. Current amplitudes depend on the animal species the channels have been isolated from and on the heterologous system used for their re-expression. Here we show that this variability is due to a unique cellular trafficking. We identified three different sequence signals responsible for the preferential expression of TWIK2 in the Lamp1-positive lysosomal compartment. Sequential inactivation of tyrosine-based (Y308ASIP) and di-leucine-like (E266LILL and D282EDDQVDIL) trafficking motifs progressively abolishes the targeting of TWIK2 to lysosomes, and promotes its functional relocation at the plasma membrane. In addition, TWIK2 contains two N-glycosylation sites (N79AS and N85AS) on its luminal side, and glycosylation is necessary for expression in lysosomes. As shown by electrophysiology and electron microscopy, TWIK2 produces functional background K+ currents in the endolysosomes, and its expression affects the number and mean size of the lysosomes. These results show that TWIK2 is expressed in lysosomes, further expanding the registry of ion channels expressed in these organelles.
format article
author Nicole Bobak
Sylvain Feliciangeli
Cheng-Chang Chen
Ismail Ben Soussia
Stefan Bittner
Sophie Pagnotta
Tobias Ruck
Martin Biel
Christian Wahl-Schott
Christian Grimm
Sven G. Meuth
Florian Lesage
author_facet Nicole Bobak
Sylvain Feliciangeli
Cheng-Chang Chen
Ismail Ben Soussia
Stefan Bittner
Sophie Pagnotta
Tobias Ruck
Martin Biel
Christian Wahl-Schott
Christian Grimm
Sven G. Meuth
Florian Lesage
author_sort Nicole Bobak
title Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
title_short Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
title_full Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
title_fullStr Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
title_full_unstemmed Recombinant tandem of pore-domains in a Weakly Inward rectifying K+ channel 2 (TWIK2) forms active lysosomal channels
title_sort recombinant tandem of pore-domains in a weakly inward rectifying k+ channel 2 (twik2) forms active lysosomal channels
publisher Nature Portfolio
publishDate 2017
url https://doaj.org/article/c08363747f7a45328c794c87466f64ca
work_keys_str_mv AT nicolebobak recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT sylvainfeliciangeli recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT chengchangchen recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT ismailbensoussia recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT stefanbittner recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT sophiepagnotta recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT tobiasruck recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT martinbiel recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT christianwahlschott recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT christiangrimm recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT svengmeuth recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
AT florianlesage recombinanttandemofporedomainsinaweaklyinwardrectifyingkchannel2twik2formsactivelysosomalchannels
_version_ 1718384742822313984