Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (e...
Guardado en:
| Autores principales: | , , , , , , , , , |
|---|---|
| Formato: | article |
| Lenguaje: | EN |
| Publicado: |
Nature Portfolio
2017
|
| Materias: | |
| Acceso en línea: | https://doaj.org/article/c24ba0c9ddd84a8aa513f1e01d006c7f |
| Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
| id |
oai:doaj.org-article:c24ba0c9ddd84a8aa513f1e01d006c7f |
|---|---|
| record_format |
dspace |
| spelling |
oai:doaj.org-article:c24ba0c9ddd84a8aa513f1e01d006c7f2021-12-02T15:05:32ZPrevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China10.1038/s41598-017-02355-22045-2322https://doaj.org/article/c24ba0c9ddd84a8aa513f1e01d006c7f2017-06-01T00:00:00Zhttps://doi.org/10.1038/s41598-017-02355-2https://doaj.org/toc/2045-2322Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m2, proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m2, hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low.Ye DuShikun ZhangMei HuQiaomei WangHaiping ShenYiping ZhangDonghai YanYuanyuan LiMan ZhangQun MengNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 7, Iss 1, Pp 1-9 (2017) |
| institution |
DOAJ |
| collection |
DOAJ |
| language |
EN |
| topic |
Medicine R Science Q |
| spellingShingle |
Medicine R Science Q Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| description |
Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m2, proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m2, hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low. |
| format |
article |
| author |
Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng |
| author_facet |
Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng |
| author_sort |
Ye Du |
| title |
Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_short |
Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_full |
Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_fullStr |
Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_full_unstemmed |
Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China |
| title_sort |
prevalence of chronic kidney disease markers: evidence from a three-million married population with fertility desire in rural china |
| publisher |
Nature Portfolio |
| publishDate |
2017 |
| url |
https://doaj.org/article/c24ba0c9ddd84a8aa513f1e01d006c7f |
| work_keys_str_mv |
AT yedu prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT shikunzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT meihu prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT qiaomeiwang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT haipingshen prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yipingzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT donghaiyan prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yuanyuanli prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT manzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT qunmeng prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina |
| _version_ |
1718388791915315200 |