Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China

Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (e...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Ye Du, Shikun Zhang, Mei Hu, Qiaomei Wang, Haiping Shen, Yiping Zhang, Donghai Yan, Yuanyuan Li, Man Zhang, Qun Meng
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2017
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/c24ba0c9ddd84a8aa513f1e01d006c7f
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:c24ba0c9ddd84a8aa513f1e01d006c7f
record_format	dspace
spelling	oai:doaj.org-article:c24ba0c9ddd84a8aa513f1e01d006c7f2021-12-02T15:05:32ZPrevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China10.1038/s41598-017-02355-22045-2322https://doaj.org/article/c24ba0c9ddd84a8aa513f1e01d006c7f2017-06-01T00:00:00Zhttps://doi.org/10.1038/s41598-017-02355-2https://doaj.org/toc/2045-2322Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m2, proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m2, hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low.Ye DuShikun ZhangMei HuQiaomei WangHaiping ShenYiping ZhangDonghai YanYuanyuan LiMan ZhangQun MengNature PortfolioarticleMedicineRScienceQENScientific Reports, Vol 7, Iss 1, Pp 1-9 (2017)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
description	Abstract We aimed to assess the prevalence of chronic kidney diseases (CKD) markers among the married residents with fertility desire in rural China. Demographic and clinical data were collected from the National Free Pre-Conception Health Examination Project. Estimated glomerular filtration rate (eGFR) < 60 mL/min//1.73 m2, proteinuria, and hematuria were defined as markers of CKD. GFR was evaluated by using serum creatinine level and the Asian-modified CKD epidemiology collaboration equation. Automated urine dry chemical and microscopic analyses were employed to identify proteinuria and hematuria. The prevalence of CKD markers was 2.92% in the 3,091,379 participants. eGFR < 60 mL/min//1.73 m2, hematuria and proteinuria was observed in 0.85%, 1.41% and 0.71%, respectively. The prevalence of CKD markers varied greatly across different geographical locations, which was the highest in the Eastern Region (3.86%; 95% confidence interval [CI]: 3.81–3.91%), moderate in the Central Region (2.80%; 95% CI: 2.77–2.82%), and lowest in the Western Region (2.62%; 95% CI: 2.59–2.65%). Hypertension, obesity, positive hepatitis B virus surface antigen (HBsAg), age (increased by every 5 years), female gender, and living area were potential risk factors for CKD. In rural China, the prevalence of CKD markers in the married couples with fertility desire is low.
format	article
author	Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng
author_facet	Ye Du Shikun Zhang Mei Hu Qiaomei Wang Haiping Shen Yiping Zhang Donghai Yan Yuanyuan Li Man Zhang Qun Meng
author_sort	Ye Du
title	Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
title_short	Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
title_full	Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
title_fullStr	Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
title_full_unstemmed	Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China
title_sort	prevalence of chronic kidney disease markers: evidence from a three-million married population with fertility desire in rural china
publisher	Nature Portfolio
publishDate	2017
url	https://doaj.org/article/c24ba0c9ddd84a8aa513f1e01d006c7f
work_keys_str_mv	AT yedu prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT shikunzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT meihu prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT qiaomeiwang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT haipingshen prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yipingzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT donghaiyan prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT yuanyuanli prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT manzhang prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina AT qunmeng prevalenceofchronickidneydiseasemarkersevidencefromathreemillionmarriedpopulationwithfertilitydesireinruralchina
_version_	1718388791915315200

Prevalence of chronic kidney disease markers: Evidence from a three-million married population with fertility desire in rural China

Ejemplares similares