Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.

The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Eu...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Sharyn J Goldstien, Lise Dupont, Frédérique Viard, Paul J Hallas, Teruaki Nishikawa, David R Schiel, Neil J Gemmell, John D D Bishop
Formato:	article
Lenguaje:	EN
Publicado:	Public Library of Science (PLoS) 2011
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/d05a8ec6cdd04786bad5676905f88d8f
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:d05a8ec6cdd04786bad5676905f88d8f
record_format	dspace
spelling	oai:doaj.org-article:d05a8ec6cdd04786bad5676905f88d8f2021-11-18T06:58:26ZGlobal phylogeography of the widely introduced North West Pacific ascidian Styela clava.1932-620310.1371/journal.pone.0016755https://doaj.org/article/d05a8ec6cdd04786bad5676905f88d8f2011-02-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/pmid/21364988/pdf/?tool=EBIhttps://doaj.org/toc/1932-6203The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world.Sharyn J GoldstienLise DupontFrédérique ViardPaul J HallasTeruaki NishikawaDavid R SchielNeil J GemmellJohn D D BishopPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 6, Iss 2, p e16755 (2011)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Sharyn J Goldstien Lise Dupont Frédérique Viard Paul J Hallas Teruaki Nishikawa David R Schiel Neil J Gemmell John D D Bishop Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
description	The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world.
format	article
author	Sharyn J Goldstien Lise Dupont Frédérique Viard Paul J Hallas Teruaki Nishikawa David R Schiel Neil J Gemmell John D D Bishop
author_facet	Sharyn J Goldstien Lise Dupont Frédérique Viard Paul J Hallas Teruaki Nishikawa David R Schiel Neil J Gemmell John D D Bishop
author_sort	Sharyn J Goldstien
title	Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_short	Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_full	Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_fullStr	Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_full_unstemmed	Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
title_sort	global phylogeography of the widely introduced north west pacific ascidian styela clava.
publisher	Public Library of Science (PLoS)
publishDate	2011
url	https://doaj.org/article/d05a8ec6cdd04786bad5676905f88d8f
work_keys_str_mv	AT sharynjgoldstien globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT lisedupont globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT frederiqueviard globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT pauljhallas globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT teruakinishikawa globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT davidrschiel globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT neiljgemmell globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT johnddbishop globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava
_version_	1718424134377013248

Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.

Ejemplares similares