Global phylogeography of the widely introduced North West Pacific ascidian Styela clava.
The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Eu...
Guardado en:
Autores principales: | , , , , , , , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Public Library of Science (PLoS)
2011
|
Materias: | |
Acceso en línea: | https://doaj.org/article/d05a8ec6cdd04786bad5676905f88d8f |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:d05a8ec6cdd04786bad5676905f88d8f |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:d05a8ec6cdd04786bad5676905f88d8f2021-11-18T06:58:26ZGlobal phylogeography of the widely introduced North West Pacific ascidian Styela clava.1932-620310.1371/journal.pone.0016755https://doaj.org/article/d05a8ec6cdd04786bad5676905f88d8f2011-02-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/pmid/21364988/pdf/?tool=EBIhttps://doaj.org/toc/1932-6203The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world.Sharyn J GoldstienLise DupontFrédérique ViardPaul J HallasTeruaki NishikawaDavid R SchielNeil J GemmellJohn D D BishopPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 6, Iss 2, p e16755 (2011) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Medicine R Science Q |
spellingShingle |
Medicine R Science Q Sharyn J Goldstien Lise Dupont Frédérique Viard Paul J Hallas Teruaki Nishikawa David R Schiel Neil J Gemmell John D D Bishop Global phylogeography of the widely introduced North West Pacific ascidian Styela clava. |
description |
The solitary ascidian Styela clava Herdman, 1882 is considered to be native to Japan, Korea, northern China and the Russian Federation in the NW Pacific, but it has spread globally over the last 80 years and is now established as an introduced species on the east and west coasts of North America, Europe, Australia and New Zealand. In eastern Canada it reaches sufficient density to be a serious pest to aquaculture concerns. We sequenced a fragment of the cytochrome oxidase subunit I mitochondrial gene (COI) from a total of 554 individuals to examine the genetic relationships of 20 S. clava populations sampled throughout the introduced and native ranges, in order to investigate invasive population characteristics. The data presented here show a moderate level of genetic diversity throughout the northern hemisphere. The southern hemisphere (particularly New Zealand) displays a greater amount of haplotype and nucleotide diversity in comparison. This species, like many other invasive species, shows a range of genetic diversities among introduced populations independent of the age of incursion. The successful establishment of this species appears to be associated with multiple incursions in many locations, while other locations appear to have experienced rapid expansion from a potentially small population with reduced genetic diversity. These contrasting patterns create difficulties when attempting to manage and mitigate a species that continues to spread among ports and marinas around the world. |
format |
article |
author |
Sharyn J Goldstien Lise Dupont Frédérique Viard Paul J Hallas Teruaki Nishikawa David R Schiel Neil J Gemmell John D D Bishop |
author_facet |
Sharyn J Goldstien Lise Dupont Frédérique Viard Paul J Hallas Teruaki Nishikawa David R Schiel Neil J Gemmell John D D Bishop |
author_sort |
Sharyn J Goldstien |
title |
Global phylogeography of the widely introduced North West Pacific ascidian Styela clava. |
title_short |
Global phylogeography of the widely introduced North West Pacific ascidian Styela clava. |
title_full |
Global phylogeography of the widely introduced North West Pacific ascidian Styela clava. |
title_fullStr |
Global phylogeography of the widely introduced North West Pacific ascidian Styela clava. |
title_full_unstemmed |
Global phylogeography of the widely introduced North West Pacific ascidian Styela clava. |
title_sort |
global phylogeography of the widely introduced north west pacific ascidian styela clava. |
publisher |
Public Library of Science (PLoS) |
publishDate |
2011 |
url |
https://doaj.org/article/d05a8ec6cdd04786bad5676905f88d8f |
work_keys_str_mv |
AT sharynjgoldstien globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT lisedupont globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT frederiqueviard globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT pauljhallas globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT teruakinishikawa globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT davidrschiel globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT neiljgemmell globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava AT johnddbishop globalphylogeographyofthewidelyintroducednorthwestpacificascidianstyelaclava |
_version_ |
1718424134377013248 |