Canagliflozin review – safety and efficacy profile in patients with T2DM

Haroon Jakher,1 Tara I Chang,2 Marilyn Tan,3 Kenneth W Mahaffey4 1Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 2Division of Nephrology, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 3Division of Endocrinology, Department of...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Jakher H, Chang TI, Tan M, Mahaffey KW
Formato:	article
Lenguaje:	EN
Publicado:	Dove Medical Press 2019
Materias:	Canagliflozin type 2 diabetes mellitus SGLT-2 inhibitor Specialties of internal medicine RC581-951
Acceso en línea:	https://doaj.org/article/d4b21752c4a54c98aaec3e0d8e547680
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:d4b21752c4a54c98aaec3e0d8e547680
record_format	dspace
spelling	oai:doaj.org-article:d4b21752c4a54c98aaec3e0d8e5476802021-12-02T10:06:48ZCanagliflozin review – safety and efficacy profile in patients with T2DM1178-7007https://doaj.org/article/d4b21752c4a54c98aaec3e0d8e5476802019-02-01T00:00:00Zhttps://www.dovepress.com/canagliflozin-review-safety-and-efficacy-profile-in-patients-with-t2dm-peer-reviewed-article-DMSOhttps://doaj.org/toc/1178-7007Haroon Jakher,1 Tara I Chang,2 Marilyn Tan,3 Kenneth W Mahaffey4 1Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 2Division of Nephrology, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 3Division of Endocrinology, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 4Stanford Center for Clinical Research, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA Abstract: Canagliflozin is a sodium glucose-cotransporter (SGLT) receptor inhibitor approved for the treatment of type 2 diabetes mellitus (T2DM). This article reviews the mechanism of action of SGLT-2 receptor inhibitors and the efficacy of canagliflozin as an antidiabetic agent, its cardiovascular and renal benefits, and safety profile. During the development of canagliflozin, Phase II trials showed an improvement in cardiac and renal biomarkers such as blood pressure, body weight, and albuminuria. The large CANVAS program showed that canagliflozin reduced the composite cardiovascular outcome of cardiovascular death, nonfatal myocardial infarction, or nonfatal stroke. The CANVAS program also showed a possible benefit of canagliflozin on a renal composite of sustained 40% reduction in estimated glomerular filtration rate, the need for renal replacement therapy, or death from renal causes. The safety profile of canagliflozin has been well characterized, and known side effects such as mycotic genital infections were confirmed in CANVAS. However, an increased risk of amputations was observed in CANVAS that requires further study. Overall, canagliflozin is an effective antidiabetic medication with cardiovascular and likely renal benefits, and with a generally well-tolerated safety profile. Results from the CREDENCE trial will further evaluate the safety and potential renal benefits of canagliflozin in patients with established diabetic nephropathy. Keywords: canagliflozin, sodium glucose-cotransporter, diabetes, CANVAS, Invokana®, renal, cardiacJakher HChang TITan MMahaffey KWDove Medical PressarticleCanagliflozintype 2 diabetes mellitusSGLT-2 inhibitorSpecialties of internal medicineRC581-951ENDiabetes, Metabolic Syndrome and Obesity: Targets and Therapy, Vol Volume 12, Pp 209-215 (2019)
institution	DOAJ
collection	DOAJ
language	EN
topic	Canagliflozin type 2 diabetes mellitus SGLT-2 inhibitor Specialties of internal medicine RC581-951
spellingShingle	Canagliflozin type 2 diabetes mellitus SGLT-2 inhibitor Specialties of internal medicine RC581-951 Jakher H Chang TI Tan M Mahaffey KW Canagliflozin review – safety and efficacy profile in patients with T2DM
description	Haroon Jakher,1 Tara I Chang,2 Marilyn Tan,3 Kenneth W Mahaffey4 1Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 2Division of Nephrology, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 3Division of Endocrinology, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA; 4Stanford Center for Clinical Research, Department of Medicine, Stanford University School of Medicine, Palo Alto, CA, USA Abstract: Canagliflozin is a sodium glucose-cotransporter (SGLT) receptor inhibitor approved for the treatment of type 2 diabetes mellitus (T2DM). This article reviews the mechanism of action of SGLT-2 receptor inhibitors and the efficacy of canagliflozin as an antidiabetic agent, its cardiovascular and renal benefits, and safety profile. During the development of canagliflozin, Phase II trials showed an improvement in cardiac and renal biomarkers such as blood pressure, body weight, and albuminuria. The large CANVAS program showed that canagliflozin reduced the composite cardiovascular outcome of cardiovascular death, nonfatal myocardial infarction, or nonfatal stroke. The CANVAS program also showed a possible benefit of canagliflozin on a renal composite of sustained 40% reduction in estimated glomerular filtration rate, the need for renal replacement therapy, or death from renal causes. The safety profile of canagliflozin has been well characterized, and known side effects such as mycotic genital infections were confirmed in CANVAS. However, an increased risk of amputations was observed in CANVAS that requires further study. Overall, canagliflozin is an effective antidiabetic medication with cardiovascular and likely renal benefits, and with a generally well-tolerated safety profile. Results from the CREDENCE trial will further evaluate the safety and potential renal benefits of canagliflozin in patients with established diabetic nephropathy. Keywords: canagliflozin, sodium glucose-cotransporter, diabetes, CANVAS, Invokana®, renal, cardiac
format	article
author	Jakher H Chang TI Tan M Mahaffey KW
author_facet	Jakher H Chang TI Tan M Mahaffey KW
author_sort	Jakher H
title	Canagliflozin review – safety and efficacy profile in patients with T2DM
title_short	Canagliflozin review – safety and efficacy profile in patients with T2DM
title_full	Canagliflozin review – safety and efficacy profile in patients with T2DM
title_fullStr	Canagliflozin review – safety and efficacy profile in patients with T2DM
title_full_unstemmed	Canagliflozin review – safety and efficacy profile in patients with T2DM
title_sort	canagliflozin review – safety and efficacy profile in patients with t2dm
publisher	Dove Medical Press
publishDate	2019
url	https://doaj.org/article/d4b21752c4a54c98aaec3e0d8e547680
work_keys_str_mv	AT jakherh canagliflozinreviewndashsafetyandefficacyprofileinpatientswitht2dm AT changti canagliflozinreviewndashsafetyandefficacyprofileinpatientswitht2dm AT tanm canagliflozinreviewndashsafetyandefficacyprofileinpatientswitht2dm AT mahaffeykw canagliflozinreviewndashsafetyandefficacyprofileinpatientswitht2dm
_version_	1718397664693846016

Canagliflozin review &ndash; safety and efficacy profile in patients with T2DM

Ejemplares similares

Canagliflozin review – safety and efficacy profile in patients with T2DM