Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair

Femoral head necrosis (FHN) is a clinically progressive disease that leads to overwhelming complications without an effective therapeutic approach. In recent decades, transplantation of mesenchymal stem cells (MSCs) has played a promising role in the treatment of FHN in the initial stage; however, t...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Xueliang Lu, Hongyu Guo, Jiaju Li, Tianyu Sun, Mingyue Xiong
Formato:	article
Lenguaje:	EN
Publicado:	Frontiers Media S.A. 2021
Materias:	femoral head necrosis cell encapsulation injectable hydrogel stem cells magnesium Biology (General) QH301-705.5
Acceso en línea:	https://doaj.org/article/d639dbe162da4add8872cc539fbfbaa5
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:d639dbe162da4add8872cc539fbfbaa5
record_format	dspace
spelling	oai:doaj.org-article:d639dbe162da4add8872cc539fbfbaa52021-12-01T01:36:48ZRecombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair2296-634X10.3389/fcell.2021.723789https://doaj.org/article/d639dbe162da4add8872cc539fbfbaa52021-11-01T00:00:00Zhttps://www.frontiersin.org/articles/10.3389/fcell.2021.723789/fullhttps://doaj.org/toc/2296-634XFemoral head necrosis (FHN) is a clinically progressive disease that leads to overwhelming complications without an effective therapeutic approach. In recent decades, transplantation of mesenchymal stem cells (MSCs) has played a promising role in the treatment of FHN in the initial stage; however, the success rate is still low because of unsuitable cell carriers and abridged osteogenic differentiation of the transplanted MSCs. Biopolymeric-derived hydrogels have been extensively applied as effective cell carriers and drug vesicles; they provide the most promising contributions in the fields of tissue engineering and regenerative medicine. However, the clinical potential of hydrogels may be limited because of inappropriate gelation, swelling, mechanical characteristics, toxicity in the cross-linking process, and self-healing ability. Naturally, gelated commercial hydrogels are not suitable for cell injection and infiltration because of their static network structure. In this study, we designed a novel thermogelling injectable hydrogel using natural silk fibroin-blended chitosan (CS) incorporated with magnesium (Mg) substitutes to improve physical cross-linking, stability, and cell osteogenic compatibility. The presented observations demonstrate that the developed injectable hydrogels can facilitate the controlled delivery of immobilized recombinant human bone morphogenic protein-2 (rhBMP-2) and rat bone marrow-derived MSCs (rBMSCs) with greater cell encapsulation efficiency, compatibility, and osteogenic differentiation. In addition, outcomes of in vivo animal studies established promising osteoinductive, bone mineral density, and bone formation rate after implantation of the injectable hydrogel scaffolds. Therefore, the developed hydrogels have great potential for clinical applications of FHN therapy.Xueliang LuHongyu GuoJiaju LiTianyu SunMingyue XiongFrontiers Media S.A.articlefemoral head necrosiscell encapsulationinjectable hydrogelstem cellsmagnesiumBiology (General)QH301-705.5ENFrontiers in Cell and Developmental Biology, Vol 9 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	femoral head necrosis cell encapsulation injectable hydrogel stem cells magnesium Biology (General) QH301-705.5
spellingShingle	femoral head necrosis cell encapsulation injectable hydrogel stem cells magnesium Biology (General) QH301-705.5 Xueliang Lu Hongyu Guo Jiaju Li Tianyu Sun Mingyue Xiong Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair
description	Femoral head necrosis (FHN) is a clinically progressive disease that leads to overwhelming complications without an effective therapeutic approach. In recent decades, transplantation of mesenchymal stem cells (MSCs) has played a promising role in the treatment of FHN in the initial stage; however, the success rate is still low because of unsuitable cell carriers and abridged osteogenic differentiation of the transplanted MSCs. Biopolymeric-derived hydrogels have been extensively applied as effective cell carriers and drug vesicles; they provide the most promising contributions in the fields of tissue engineering and regenerative medicine. However, the clinical potential of hydrogels may be limited because of inappropriate gelation, swelling, mechanical characteristics, toxicity in the cross-linking process, and self-healing ability. Naturally, gelated commercial hydrogels are not suitable for cell injection and infiltration because of their static network structure. In this study, we designed a novel thermogelling injectable hydrogel using natural silk fibroin-blended chitosan (CS) incorporated with magnesium (Mg) substitutes to improve physical cross-linking, stability, and cell osteogenic compatibility. The presented observations demonstrate that the developed injectable hydrogels can facilitate the controlled delivery of immobilized recombinant human bone morphogenic protein-2 (rhBMP-2) and rat bone marrow-derived MSCs (rBMSCs) with greater cell encapsulation efficiency, compatibility, and osteogenic differentiation. In addition, outcomes of in vivo animal studies established promising osteoinductive, bone mineral density, and bone formation rate after implantation of the injectable hydrogel scaffolds. Therefore, the developed hydrogels have great potential for clinical applications of FHN therapy.
format	article
author	Xueliang Lu Hongyu Guo Jiaju Li Tianyu Sun Mingyue Xiong
author_facet	Xueliang Lu Hongyu Guo Jiaju Li Tianyu Sun Mingyue Xiong
author_sort	Xueliang Lu
title	Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair
title_short	Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair
title_full	Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair
title_fullStr	Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair
title_full_unstemmed	Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair
title_sort	recombinant human bone morphogenic protein-2 immobilized fabrication of magnesium functionalized injectable hydrogels for controlled-delivery and osteogenic differentiation of rat bone marrow-derived mesenchymal stem cells in femoral head necrosis repair
publisher	Frontiers Media S.A.
publishDate	2021
url	https://doaj.org/article/d639dbe162da4add8872cc539fbfbaa5
work_keys_str_mv	AT xuelianglu recombinanthumanbonemorphogenicprotein2immobilizedfabricationofmagnesiumfunctionalizedinjectablehydrogelsforcontrolleddeliveryandosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsinfemoralheadnecrosisrepair AT hongyuguo recombinanthumanbonemorphogenicprotein2immobilizedfabricationofmagnesiumfunctionalizedinjectablehydrogelsforcontrolleddeliveryandosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsinfemoralheadnecrosisrepair AT jiajuli recombinanthumanbonemorphogenicprotein2immobilizedfabricationofmagnesiumfunctionalizedinjectablehydrogelsforcontrolleddeliveryandosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsinfemoralheadnecrosisrepair AT tianyusun recombinanthumanbonemorphogenicprotein2immobilizedfabricationofmagnesiumfunctionalizedinjectablehydrogelsforcontrolleddeliveryandosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsinfemoralheadnecrosisrepair AT mingyuexiong recombinanthumanbonemorphogenicprotein2immobilizedfabricationofmagnesiumfunctionalizedinjectablehydrogelsforcontrolleddeliveryandosteogenicdifferentiationofratbonemarrowderivedmesenchymalstemcellsinfemoralheadnecrosisrepair
_version_	1718405990563446784

Recombinant Human Bone Morphogenic Protein-2 Immobilized Fabrication of Magnesium Functionalized Injectable Hydrogels for Controlled-Delivery and Osteogenic Differentiation of Rat Bone Marrow-Derived Mesenchymal Stem Cells in Femoral Head Necrosis Repair

Ejemplares similares