ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.

The endoplasmic reticulum (ER) has a unique, network-like morphology. The ER structures are composed of tubules, cisternae, and three-way junctions. This morphology is highly conserved among eukaryotes, but the molecular mechanism that maintains ER morphology has not yet been elucidated. In addition...

Full description

Saved in:
Bibliographic Details
Main Authors: Ryohei Thomas Nakano, Ryo Matsushima, Atsushi J Nagano, Yoichiro Fukao, Masayuki Fujiwara, Maki Kondo, Mikio Nishimura, Ikuko Hara-Nishimura
Format: article
Language:EN
Published: Public Library of Science (PLoS) 2012
Subjects:
R
Q
Online Access:https://doaj.org/article/d6d87fff864544d390942e0c297ec686
Tags: Add Tag
No Tags, Be the first to tag this record!
id oai:doaj.org-article:d6d87fff864544d390942e0c297ec686
record_format dspace
spelling oai:doaj.org-article:d6d87fff864544d390942e0c297ec6862021-11-18T08:08:49ZERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.1932-620310.1371/journal.pone.0049103https://doaj.org/article/d6d87fff864544d390942e0c297ec6862012-01-01T00:00:00Zhttps://www.ncbi.nlm.nih.gov/pmc/articles/pmid/23155454/pdf/?tool=EBIhttps://doaj.org/toc/1932-6203The endoplasmic reticulum (ER) has a unique, network-like morphology. The ER structures are composed of tubules, cisternae, and three-way junctions. This morphology is highly conserved among eukaryotes, but the molecular mechanism that maintains ER morphology has not yet been elucidated. In addition, certain Brassicaceae plants develop a unique ER-derived organelle called the ER body. This organelle accumulates large amounts of PYK10, a β-glucosidase, but its physiological functions are still obscure. We aimed to identify a novel factor required for maintaining the morphology of the ER, including ER bodies, and employed a forward-genetic approach using transgenic Arabidopsis thaliana (GFP-h) with fluorescently-labeled ER. We isolated and investigated a mutant (designated endoplasmic reticulum morphology3, ermo3) with huge aggregates and abnormal punctate structures of ER. ERMO3 encodes a GDSL-lipase/esterase family protein, also known as MVP1. Here, we showed that, although ERMO3/MVP1/GOLD36 was expressed ubiquitously, the morphological defects of ermo3 were specifically seen in a certain type of cells where ER bodies developed. Coimmunoprecipitation analysis combined with mass spectrometry revealed that ERMO3/MVP1/GOLD36 interacts with the PYK10 complex, a huge protein complex that is thought to be important for ER body-related defense systems. We also found that the depletion of transcription factor NAI1, a master regulator for ER body formation, suppressed the formation of ER-aggregates in ermo3 cells, suggesting that NAI1 expression plays an important role in the abnormal aggregation of ER. Our results suggest that ERMO3/MVP1/GOLD36 is required for preventing ER and other organelles from abnormal aggregation and for maintaining proper ER morphology in a coordinated manner with NAI1.Ryohei Thomas NakanoRyo MatsushimaAtsushi J NaganoYoichiro FukaoMasayuki FujiwaraMaki KondoMikio NishimuraIkuko Hara-NishimuraPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 7, Iss 11, p e49103 (2012)
institution DOAJ
collection DOAJ
language EN
topic Medicine
R
Science
Q
spellingShingle Medicine
R
Science
Q
Ryohei Thomas Nakano
Ryo Matsushima
Atsushi J Nagano
Yoichiro Fukao
Masayuki Fujiwara
Maki Kondo
Mikio Nishimura
Ikuko Hara-Nishimura
ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.
description The endoplasmic reticulum (ER) has a unique, network-like morphology. The ER structures are composed of tubules, cisternae, and three-way junctions. This morphology is highly conserved among eukaryotes, but the molecular mechanism that maintains ER morphology has not yet been elucidated. In addition, certain Brassicaceae plants develop a unique ER-derived organelle called the ER body. This organelle accumulates large amounts of PYK10, a β-glucosidase, but its physiological functions are still obscure. We aimed to identify a novel factor required for maintaining the morphology of the ER, including ER bodies, and employed a forward-genetic approach using transgenic Arabidopsis thaliana (GFP-h) with fluorescently-labeled ER. We isolated and investigated a mutant (designated endoplasmic reticulum morphology3, ermo3) with huge aggregates and abnormal punctate structures of ER. ERMO3 encodes a GDSL-lipase/esterase family protein, also known as MVP1. Here, we showed that, although ERMO3/MVP1/GOLD36 was expressed ubiquitously, the morphological defects of ermo3 were specifically seen in a certain type of cells where ER bodies developed. Coimmunoprecipitation analysis combined with mass spectrometry revealed that ERMO3/MVP1/GOLD36 interacts with the PYK10 complex, a huge protein complex that is thought to be important for ER body-related defense systems. We also found that the depletion of transcription factor NAI1, a master regulator for ER body formation, suppressed the formation of ER-aggregates in ermo3 cells, suggesting that NAI1 expression plays an important role in the abnormal aggregation of ER. Our results suggest that ERMO3/MVP1/GOLD36 is required for preventing ER and other organelles from abnormal aggregation and for maintaining proper ER morphology in a coordinated manner with NAI1.
format article
author Ryohei Thomas Nakano
Ryo Matsushima
Atsushi J Nagano
Yoichiro Fukao
Masayuki Fujiwara
Maki Kondo
Mikio Nishimura
Ikuko Hara-Nishimura
author_facet Ryohei Thomas Nakano
Ryo Matsushima
Atsushi J Nagano
Yoichiro Fukao
Masayuki Fujiwara
Maki Kondo
Mikio Nishimura
Ikuko Hara-Nishimura
author_sort Ryohei Thomas Nakano
title ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.
title_short ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.
title_full ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.
title_fullStr ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.
title_full_unstemmed ERMO3/MVP1/GOLD36 is involved in a cell type-specific mechanism for maintaining ER morphology in Arabidopsis thaliana.
title_sort ermo3/mvp1/gold36 is involved in a cell type-specific mechanism for maintaining er morphology in arabidopsis thaliana.
publisher Public Library of Science (PLoS)
publishDate 2012
url https://doaj.org/article/d6d87fff864544d390942e0c297ec686
work_keys_str_mv AT ryoheithomasnakano ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT ryomatsushima ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT atsushijnagano ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT yoichirofukao ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT masayukifujiwara ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT makikondo ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT mikionishimura ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
AT ikukoharanishimura ermo3mvp1gold36isinvolvedinacelltypespecificmechanismformaintainingermorphologyinarabidopsisthaliana
_version_ 1718422198989881344