Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.

Epiplakin, a member of the plakin protein family, is exclusively expressed in epithelial tissues and was shown to bind to keratins. Epiplakin-deficient (EPPK-/-) mice showed no obvious spontaneous phenotype, however, EPPK-/- keratinocytes displayed faster keratin network breakdown in response to str...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Karl L Wögenstein, Sandra Szabo, Mariia Lunova, Gerhard Wiche, Johannes Haybaeck, Pavel Strnad, Peter Boor, Martin Wagner, Peter Fuchs
Formato:	article
Lenguaje:	EN
Publicado:	Public Library of Science (PLoS) 2014
Materias:	Medicine R Science Q
Acceso en línea:	https://doaj.org/article/d948532638674358bd06067cd40bb857
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:d948532638674358bd06067cd40bb857
record_format	dspace
spelling	oai:doaj.org-article:d948532638674358bd06067cd40bb8572021-11-25T06:00:13ZEpiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.1932-620310.1371/journal.pone.0108323https://doaj.org/article/d948532638674358bd06067cd40bb8572014-01-01T00:00:00Zhttps://doi.org/10.1371/journal.pone.0108323https://doaj.org/toc/1932-6203Epiplakin, a member of the plakin protein family, is exclusively expressed in epithelial tissues and was shown to bind to keratins. Epiplakin-deficient (EPPK-/-) mice showed no obvious spontaneous phenotype, however, EPPK-/- keratinocytes displayed faster keratin network breakdown in response to stress. The role of epiplakin in pancreas, a tissue with abundant keratin expression, was not yet known. We analyzed epiplakin's expression in healthy and inflamed pancreatic tissue and compared wild-type and EPPK-/- mice during caerulein-induced acute pancreatitis. We found that epiplakin was expressed primarily in ductal cells of the pancreas and colocalized with apicolateral keratin bundles in murine pancreatic acinar cells. Epiplakin's diffuse subcellular localization in keratin filament-free acini of K8-deficient mice indicated that its filament-associated localization in acinar cells completely depends on its binding partner keratin. During acute pancreatitis, epiplakin was upregulated in acinar cells and its redistribution closely paralleled keratin reorganization. EPPK-/- mice suffered from aggravated pancreatitis but showed no obvious regeneration phenotype. At the most severe stage of the disease, EPPK-/- acinar cells displayed more keratin aggregates than those of wild-type mice. Our data propose epiplakin to be a protective protein during acute pancreatitis, and that its loss causes impaired disease-associated keratin reorganization.Karl L WögensteinSandra SzaboMariia LunovaGerhard WicheJohannes HaybaeckPavel StrnadPeter BoorMartin WagnerPeter FuchsPublic Library of Science (PLoS)articleMedicineRScienceQENPLoS ONE, Vol 9, Iss 9, p e108323 (2014)
institution	DOAJ
collection	DOAJ
language	EN
topic	Medicine R Science Q
spellingShingle	Medicine R Science Q Karl L Wögenstein Sandra Szabo Mariia Lunova Gerhard Wiche Johannes Haybaeck Pavel Strnad Peter Boor Martin Wagner Peter Fuchs Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
description	Epiplakin, a member of the plakin protein family, is exclusively expressed in epithelial tissues and was shown to bind to keratins. Epiplakin-deficient (EPPK-/-) mice showed no obvious spontaneous phenotype, however, EPPK-/- keratinocytes displayed faster keratin network breakdown in response to stress. The role of epiplakin in pancreas, a tissue with abundant keratin expression, was not yet known. We analyzed epiplakin's expression in healthy and inflamed pancreatic tissue and compared wild-type and EPPK-/- mice during caerulein-induced acute pancreatitis. We found that epiplakin was expressed primarily in ductal cells of the pancreas and colocalized with apicolateral keratin bundles in murine pancreatic acinar cells. Epiplakin's diffuse subcellular localization in keratin filament-free acini of K8-deficient mice indicated that its filament-associated localization in acinar cells completely depends on its binding partner keratin. During acute pancreatitis, epiplakin was upregulated in acinar cells and its redistribution closely paralleled keratin reorganization. EPPK-/- mice suffered from aggravated pancreatitis but showed no obvious regeneration phenotype. At the most severe stage of the disease, EPPK-/- acinar cells displayed more keratin aggregates than those of wild-type mice. Our data propose epiplakin to be a protective protein during acute pancreatitis, and that its loss causes impaired disease-associated keratin reorganization.
format	article
author	Karl L Wögenstein Sandra Szabo Mariia Lunova Gerhard Wiche Johannes Haybaeck Pavel Strnad Peter Boor Martin Wagner Peter Fuchs
author_facet	Karl L Wögenstein Sandra Szabo Mariia Lunova Gerhard Wiche Johannes Haybaeck Pavel Strnad Peter Boor Martin Wagner Peter Fuchs
author_sort	Karl L Wögenstein
title	Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
title_short	Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
title_full	Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
title_fullStr	Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
title_full_unstemmed	Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
title_sort	epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.
publisher	Public Library of Science (PLoS)
publishDate	2014
url	https://doaj.org/article/d948532638674358bd06067cd40bb857
work_keys_str_mv	AT karllwogenstein epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT sandraszabo epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT mariialunova epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT gerhardwiche epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT johanneshaybaeck epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT pavelstrnad epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT peterboor epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT martinwagner epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules AT peterfuchs epiplakindeficiencyaggravatesmurinecaeruleininducedacutepancreatitisandfavorstheformationofacinarkeratingranules
_version_	1718414309960187904

Epiplakin deficiency aggravates murine caerulein-induced acute pancreatitis and favors the formation of acinar keratin granules.

Ejemplares similares