Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells

Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells

Xiaoqing Chen, Yaqin Liu, Zhaoxin Jiang, Lian Zhou, Jian Ge, Qianying GaoState Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou, People’s Republic of ChinaAbstract: We previously found that downregulation of protein kinase Cα...

Descripción completa

Guardado en:
Detalles Bibliográficos
Autores principales: Chen X, Liu Y, Jiang Z, Zhou L, Ge J, Gao Q
Formato: article
Lenguaje:EN
Publicado: Dove Medical Press 2011
Materias:
Medicine (General)
R5-920
Acceso en línea:https://doaj.org/article/d9d823b5d07c472ca5f36375c107e66a
Etiquetas: Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
id oai:doaj.org-article:d9d823b5d07c472ca5f36375c107e66a
record_format dspace
spelling oai:doaj.org-article:d9d823b5d07c472ca5f36375c107e66a2021-12-02T00:14:21ZProtein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells1176-91141178-2013https://doaj.org/article/d9d823b5d07c472ca5f36375c107e66a2011-06-01T00:00:00Zhttp://www.dovepress.com/protein-kinase-calpha-downregulation-via-sirna-pkcalpha-released-from--a7709https://doaj.org/toc/1176-9114https://doaj.org/toc/1178-2013Xiaoqing Chen, Yaqin Liu, Zhaoxin Jiang, Lian Zhou, Jian Ge, Qianying GaoState Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou, People’s Republic of ChinaAbstract: We previously found that downregulation of protein kinase Cα (PKCα) can inhibit retinal pigment epithelium (RPE) cell proliferation involved in the development of proliferative vitreoretinopathy (PVR). In this study, we tested whether PKCα could be downregulated via small interfering RNA (siRNA)-PKCα released from foldable capsular vitreous body (FCVB) in cultured human RPE cells. SiRNA-PKCα content, determined by ultraviolet (UV) spectrophotometer, was released from FCVB containing 200, 300, 400, 500, and 600 nm siRNA-PKCα in a time-dependent manner from 1 to 96 hours and a dose-dependent manner at five concentrations. The content (y) had a good linear relationship with time (x), especially in the 600 nm siRNA-PKCα group (y = 16.214x, R2 = 0.9809). After treatment with siRNA-PKCα released from FCVBs, the PKCα was significantly decreased by RT-PCR, Western blot, and immunofluorescence analysis in RPE cells. These results indicate that PKCα was significantly downregulated by siRNA-PKCα released from FCVB in human RPE cells and provide us with a new avenue to prevent PVR.Keywords: small interfering RNA–protein kinase Cα, foldable capsular vitreous body, drug delivery system, retinal pigment epithelium, protein kinase CαChen XLiu YJiang ZZhou LGe JGao QDove Medical PressarticleMedicine (General)R5-920ENInternational Journal of Nanomedicine, Vol 2011, Iss default, Pp 1303-1311 (2011)
institution DOAJ
collection DOAJ
language EN
topic Medicine (General)
R5-920
spellingShingle Medicine (General)
R5-920
Chen X
Liu Y
Jiang Z
Zhou L
Ge J
Gao Q
Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
description Xiaoqing Chen, Yaqin Liu, Zhaoxin Jiang, Lian Zhou, Jian Ge, Qianying GaoState Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou, People’s Republic of ChinaAbstract: We previously found that downregulation of protein kinase Cα (PKCα) can inhibit retinal pigment epithelium (RPE) cell proliferation involved in the development of proliferative vitreoretinopathy (PVR). In this study, we tested whether PKCα could be downregulated via small interfering RNA (siRNA)-PKCα released from foldable capsular vitreous body (FCVB) in cultured human RPE cells. SiRNA-PKCα content, determined by ultraviolet (UV) spectrophotometer, was released from FCVB containing 200, 300, 400, 500, and 600 nm siRNA-PKCα in a time-dependent manner from 1 to 96 hours and a dose-dependent manner at five concentrations. The content (y) had a good linear relationship with time (x), especially in the 600 nm siRNA-PKCα group (y = 16.214x, R2 = 0.9809). After treatment with siRNA-PKCα released from FCVBs, the PKCα was significantly decreased by RT-PCR, Western blot, and immunofluorescence analysis in RPE cells. These results indicate that PKCα was significantly downregulated by siRNA-PKCα released from FCVB in human RPE cells and provide us with a new avenue to prevent PVR.Keywords: small interfering RNA–protein kinase Cα, foldable capsular vitreous body, drug delivery system, retinal pigment epithelium, protein kinase Cα
format article
author Chen X
Liu Y
Jiang Z
Zhou L
Ge J
Gao Q
author_facet Chen X
Liu Y
Jiang Z
Zhou L
Ge J
Gao Q
author_sort Chen X
title Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
title_short Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
title_full Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
title_fullStr Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
title_full_unstemmed Protein kinase Cα downregulation via siRNA-PKCα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
title_sort protein kinase cα downregulation via sirna-pkcα released from foldable capsular vitreous body in cultured human retinal pigment epithelium cells
publisher Dove Medical Press
publishDate 2011
url https://doaj.org/article/d9d823b5d07c472ca5f36375c107e66a
work_keys_str_mv AT chenx proteinkinasecampalphadownregulationviasirnapkcampalphareleasedfromfoldablecapsularvitreousbodyinculturedhumanretinalpigmentepitheliumcells
AT liuy proteinkinasecampalphadownregulationviasirnapkcampalphareleasedfromfoldablecapsularvitreousbodyinculturedhumanretinalpigmentepitheliumcells
AT jiangz proteinkinasecampalphadownregulationviasirnapkcampalphareleasedfromfoldablecapsularvitreousbodyinculturedhumanretinalpigmentepitheliumcells
AT zhoul proteinkinasecampalphadownregulationviasirnapkcampalphareleasedfromfoldablecapsularvitreousbodyinculturedhumanretinalpigmentepitheliumcells
AT gej proteinkinasecampalphadownregulationviasirnapkcampalphareleasedfromfoldablecapsularvitreousbodyinculturedhumanretinalpigmentepitheliumcells
AT gaoq proteinkinasecampalphadownregulationviasirnapkcampalphareleasedfromfoldablecapsularvitreousbodyinculturedhumanretinalpigmentepitheliumcells
_version_ 1718403895127965696

Ejemplares similares