Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
Abstract Background Wall-associated kinase (WAK)/WAK-like (WAKL) is one of the subfamily of receptor like kinases (RLK). Although previous studies reported that WAK/WAKL played an important role in plant cell elongation, response to biotic and abiotic stresses, there are no systematic studies on RcW...
Guardado en:
| Autores principales: | , , , , , , , |
|---|---|
| Formato: | article |
| Lenguaje: | EN |
| Publicado: |
BMC
2021
|
| Materias: | |
| Acceso en línea: | https://doaj.org/article/da82ce2abd4e4babafe6859b397a39eb |
| Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
| id |
oai:doaj.org-article:da82ce2abd4e4babafe6859b397a39eb |
|---|---|
| record_format |
dspace |
| spelling |
oai:doaj.org-article:da82ce2abd4e4babafe6859b397a39eb2021-11-14T12:09:16ZCharacterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance10.1186/s12870-021-03307-91471-2229https://doaj.org/article/da82ce2abd4e4babafe6859b397a39eb2021-11-01T00:00:00Zhttps://doi.org/10.1186/s12870-021-03307-9https://doaj.org/toc/1471-2229Abstract Background Wall-associated kinase (WAK)/WAK-like (WAKL) is one of the subfamily of receptor like kinases (RLK). Although previous studies reported that WAK/WAKL played an important role in plant cell elongation, response to biotic and abiotic stresses, there are no systematic studies on RcWAK/RcWAKL in rose. Results In this study, we identified a total of 68 RcWAK/RcWAKL gene family members within rose (Rosa chinensis) genome. The RcWAKs contained the extracellular galacturonan-binding domain and calcium-binding epidermal growth factor (EGF)-like domain, as well as an intracellular kinase domains. The RcWAKLs are missing either calcium-binding EGF-like domain or the galacturonan-binding domain in their extracellular region. The phylogenetic analysis showed the RcWAK/RcWAKL gene family has been divided into five groups, and these RcWAK/RcWAKL genes were unevenly distributed on the 7 chromosomes of rose. 12 of RcWAK/RcWAKL genes were significantly up-regulated by Botrytis cinerea-inoculated rose petals, where RcWAK4 was the most strongly expressed. Virus induced gene silencing of RcWAK4 increased the rose petal sensitivity to B. cinerea. The results indicated RcWAK4 is involved in the resistance of rose petal against B. cinerea. Conclusion Our study provides useful information to further investigate the function of the RcWAK/RcWAKL gene family and breeding research for resistance to B. cinerea in rose.Xintong LiuZicheng WangYu TianShiya ZhangDandan LiWenqi DongChangqing ZhangZhao ZhangBMCarticleRosa chinensisWAKWAKLBotrytis cinereagrey mold diseaseimmune responseBotanyQK1-989ENBMC Plant Biology, Vol 21, Iss 1, Pp 1-12 (2021) |
| institution |
DOAJ |
| collection |
DOAJ |
| language |
EN |
| topic |
Rosa chinensis WAK WAKL Botrytis cinerea grey mold disease immune response Botany QK1-989 |
| spellingShingle |
Rosa chinensis WAK WAKL Botrytis cinerea grey mold disease immune response Botany QK1-989 Xintong Liu Zicheng Wang Yu Tian Shiya Zhang Dandan Li Wenqi Dong Changqing Zhang Zhao Zhang Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance |
| description |
Abstract Background Wall-associated kinase (WAK)/WAK-like (WAKL) is one of the subfamily of receptor like kinases (RLK). Although previous studies reported that WAK/WAKL played an important role in plant cell elongation, response to biotic and abiotic stresses, there are no systematic studies on RcWAK/RcWAKL in rose. Results In this study, we identified a total of 68 RcWAK/RcWAKL gene family members within rose (Rosa chinensis) genome. The RcWAKs contained the extracellular galacturonan-binding domain and calcium-binding epidermal growth factor (EGF)-like domain, as well as an intracellular kinase domains. The RcWAKLs are missing either calcium-binding EGF-like domain or the galacturonan-binding domain in their extracellular region. The phylogenetic analysis showed the RcWAK/RcWAKL gene family has been divided into five groups, and these RcWAK/RcWAKL genes were unevenly distributed on the 7 chromosomes of rose. 12 of RcWAK/RcWAKL genes were significantly up-regulated by Botrytis cinerea-inoculated rose petals, where RcWAK4 was the most strongly expressed. Virus induced gene silencing of RcWAK4 increased the rose petal sensitivity to B. cinerea. The results indicated RcWAK4 is involved in the resistance of rose petal against B. cinerea. Conclusion Our study provides useful information to further investigate the function of the RcWAK/RcWAKL gene family and breeding research for resistance to B. cinerea in rose. |
| format |
article |
| author |
Xintong Liu Zicheng Wang Yu Tian Shiya Zhang Dandan Li Wenqi Dong Changqing Zhang Zhao Zhang |
| author_facet |
Xintong Liu Zicheng Wang Yu Tian Shiya Zhang Dandan Li Wenqi Dong Changqing Zhang Zhao Zhang |
| author_sort |
Xintong Liu |
| title |
Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance |
| title_short |
Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance |
| title_full |
Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance |
| title_fullStr |
Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance |
| title_full_unstemmed |
Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance |
| title_sort |
characterization of wall-associated kinase/wall-associated kinase-like (wak/wakl) family in rose (rosa chinensis) reveals the role of rcwak4 in botrytis resistance |
| publisher |
BMC |
| publishDate |
2021 |
| url |
https://doaj.org/article/da82ce2abd4e4babafe6859b397a39eb |
| work_keys_str_mv |
AT xintongliu characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT zichengwang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT yutian characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT shiyazhang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT dandanli characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT wenqidong characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT changqingzhang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT zhaozhang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance |
| _version_ |
1718429436593831936 |