Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance

Abstract Background Wall-associated kinase (WAK)/WAK-like (WAKL) is one of the subfamily of receptor like kinases (RLK). Although previous studies reported that WAK/WAKL played an important role in plant cell elongation, response to biotic and abiotic stresses, there are no systematic studies on RcW...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Xintong Liu, Zicheng Wang, Yu Tian, Shiya Zhang, Dandan Li, Wenqi Dong, Changqing Zhang, Zhao Zhang
Formato:	article
Lenguaje:	EN
Publicado:	BMC 2021
Materias:	Rosa chinensis WAK WAKL Botrytis cinerea grey mold disease immune response Botany QK1-989
Acceso en línea:	https://doaj.org/article/da82ce2abd4e4babafe6859b397a39eb
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:da82ce2abd4e4babafe6859b397a39eb
record_format	dspace
spelling	oai:doaj.org-article:da82ce2abd4e4babafe6859b397a39eb2021-11-14T12:09:16ZCharacterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance10.1186/s12870-021-03307-91471-2229https://doaj.org/article/da82ce2abd4e4babafe6859b397a39eb2021-11-01T00:00:00Zhttps://doi.org/10.1186/s12870-021-03307-9https://doaj.org/toc/1471-2229Abstract Background Wall-associated kinase (WAK)/WAK-like (WAKL) is one of the subfamily of receptor like kinases (RLK). Although previous studies reported that WAK/WAKL played an important role in plant cell elongation, response to biotic and abiotic stresses, there are no systematic studies on RcWAK/RcWAKL in rose. Results In this study, we identified a total of 68 RcWAK/RcWAKL gene family members within rose (Rosa chinensis) genome. The RcWAKs contained the extracellular galacturonan-binding domain and calcium-binding epidermal growth factor (EGF)-like domain, as well as an intracellular kinase domains. The RcWAKLs are missing either calcium-binding EGF-like domain or the galacturonan-binding domain in their extracellular region. The phylogenetic analysis showed the RcWAK/RcWAKL gene family has been divided into five groups, and these RcWAK/RcWAKL genes were unevenly distributed on the 7 chromosomes of rose. 12 of RcWAK/RcWAKL genes were significantly up-regulated by Botrytis cinerea-inoculated rose petals, where RcWAK4 was the most strongly expressed. Virus induced gene silencing of RcWAK4 increased the rose petal sensitivity to B. cinerea. The results indicated RcWAK4 is involved in the resistance of rose petal against B. cinerea. Conclusion Our study provides useful information to further investigate the function of the RcWAK/RcWAKL gene family and breeding research for resistance to B. cinerea in rose.Xintong LiuZicheng WangYu TianShiya ZhangDandan LiWenqi DongChangqing ZhangZhao ZhangBMCarticleRosa chinensisWAKWAKLBotrytis cinereagrey mold diseaseimmune responseBotanyQK1-989ENBMC Plant Biology, Vol 21, Iss 1, Pp 1-12 (2021)
institution	DOAJ
collection	DOAJ
language	EN
topic	Rosa chinensis WAK WAKL Botrytis cinerea grey mold disease immune response Botany QK1-989
spellingShingle	Rosa chinensis WAK WAKL Botrytis cinerea grey mold disease immune response Botany QK1-989 Xintong Liu Zicheng Wang Yu Tian Shiya Zhang Dandan Li Wenqi Dong Changqing Zhang Zhao Zhang Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
description	Abstract Background Wall-associated kinase (WAK)/WAK-like (WAKL) is one of the subfamily of receptor like kinases (RLK). Although previous studies reported that WAK/WAKL played an important role in plant cell elongation, response to biotic and abiotic stresses, there are no systematic studies on RcWAK/RcWAKL in rose. Results In this study, we identified a total of 68 RcWAK/RcWAKL gene family members within rose (Rosa chinensis) genome. The RcWAKs contained the extracellular galacturonan-binding domain and calcium-binding epidermal growth factor (EGF)-like domain, as well as an intracellular kinase domains. The RcWAKLs are missing either calcium-binding EGF-like domain or the galacturonan-binding domain in their extracellular region. The phylogenetic analysis showed the RcWAK/RcWAKL gene family has been divided into five groups, and these RcWAK/RcWAKL genes were unevenly distributed on the 7 chromosomes of rose. 12 of RcWAK/RcWAKL genes were significantly up-regulated by Botrytis cinerea-inoculated rose petals, where RcWAK4 was the most strongly expressed. Virus induced gene silencing of RcWAK4 increased the rose petal sensitivity to B. cinerea. The results indicated RcWAK4 is involved in the resistance of rose petal against B. cinerea. Conclusion Our study provides useful information to further investigate the function of the RcWAK/RcWAKL gene family and breeding research for resistance to B. cinerea in rose.
format	article
author	Xintong Liu Zicheng Wang Yu Tian Shiya Zhang Dandan Li Wenqi Dong Changqing Zhang Zhao Zhang
author_facet	Xintong Liu Zicheng Wang Yu Tian Shiya Zhang Dandan Li Wenqi Dong Changqing Zhang Zhao Zhang
author_sort	Xintong Liu
title	Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
title_short	Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
title_full	Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
title_fullStr	Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
title_full_unstemmed	Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance
title_sort	characterization of wall-associated kinase/wall-associated kinase-like (wak/wakl) family in rose (rosa chinensis) reveals the role of rcwak4 in botrytis resistance
publisher	BMC
publishDate	2021
url	https://doaj.org/article/da82ce2abd4e4babafe6859b397a39eb
work_keys_str_mv	AT xintongliu characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT zichengwang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT yutian characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT shiyazhang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT dandanli characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT wenqidong characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT changqingzhang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance AT zhaozhang characterizationofwallassociatedkinasewallassociatedkinaselikewakwaklfamilyinroserosachinensisrevealstheroleofrcwak4inbotrytisresistance
_version_	1718429436593831936

Characterization of wall-associated kinase/wall-associated kinase-like (WAK/WAKL) family in rose (Rosa chinensis) reveals the role of RcWAK4 in Botrytis resistance

Ejemplares similares