Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up

Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a...

Descripción completa

Guardado en:
Detalles Bibliográficos
Autores principales: Celestino Sardu, Massimo Massetti, Nicola Testa, Luigi Di Martino, Gaetano Castellano, Fabrizio Turriziani, Ferdinando Carlo Sasso, Michele Torella, Marisa De Feo, Gaetano Santulli, Giuseppe Paolisso, Raffaele Marfella
Formato: article
Lenguaje:EN
Publicado: Frontiers Media S.A. 2021
Materias:
Acceso en línea:https://doaj.org/article/f33bf0978d55443e8ab8cb98ecd53960
Etiquetas: Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
id oai:doaj.org-article:f33bf0978d55443e8ab8cb98ecd53960
record_format dspace
spelling oai:doaj.org-article:f33bf0978d55443e8ab8cb98ecd539602021-11-15T06:56:11ZEffects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up1663-981210.3389/fphar.2021.777083https://doaj.org/article/f33bf0978d55443e8ab8cb98ecd539602021-11-01T00:00:00Zhttps://www.frontiersin.org/articles/10.3389/fphar.2021.777083/fullhttps://doaj.org/toc/1663-9812Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a worse prognosis, caused by over-inflammation and modulated by sodium-glucose transporter 2 receptors. However, we evaluated the inflammatory burden and clinical outcomes in non-T2DM vs T2DM patients under sodium-glucose transporter 2 inhibitors (SGLT2-I users) vs non-SGLT2-I users at 5 years of follow-up post-CABG via MiECC.Materials and methods: In a multicenter study, we screened consecutive patients with indications to receive CABG. The study endpoints were the inflammatory burden (circulating serum levels of tumor necrosis factor-alpha (TNF-α), interleukin 1 and 6 (IL-1 and IL-6), C-reactive protein (CRP), and leucocytes count) and the clinical outcomes at follow-up of 5 years in non-T2DM vs SGLT2-I users, in non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users.Results: At baseline, and at one year and 5 years of follow-up, the non-T2DM vs SGLT2-I users, non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users had the lowest values of IL-1, IL-6, and TNF-α (p < 0.05). At one year of follow-up, SGLT2-I users vs non-T2DM and non-SGLT2-I users vs non-T2DM users had a higher rate of all deaths, cardiac deaths, re-myocardial infarction, repeat revascularization, and stroke, and of the composite endpoint (p < 0.05). In a multivariate Cox regression analysis, the composite endpoint was predicted by IL-1 [2.068 (1.367–3.129)], TNF-α [1.989 (1.081–2.998)], and SGLT2-I [0.504 (0.078–0.861)].Conclusion: In T2DM patients, the SGLT2-I significantly reduced the inflammatory burden and ameliorated clinical outcomes at 5 years of follow-up post-CABG via MiECC.Celestino SarduCelestino SarduMassimo MassettiMassimo MassettiNicola TestaLuigi Di MartinoGaetano CastellanoFabrizio TurrizianiFerdinando Carlo SassoMichele TorellaMarisa De FeoGaetano SantulliGaetano SantulliGaetano SantulliGiuseppe PaolissoGiuseppe PaolissoRaffaele MarfellaRaffaele MarfellaFrontiers Media S.A.articletype 2 diabetes mellitus, coronary heart diseasecoronary artery bypass graftingsodium-glucose transporter 2 inhibitorsminimally invasive extracorporeal circulationmulti-vessel coronary stenosisover-inflammationTherapeutics. PharmacologyRM1-950ENFrontiers in Pharmacology, Vol 12 (2021)
institution DOAJ
collection DOAJ
language EN
topic type 2 diabetes mellitus, coronary heart disease
coronary artery bypass grafting
sodium-glucose transporter 2 inhibitors
minimally invasive extracorporeal circulation
multi-vessel coronary stenosis
over-inflammation
Therapeutics. Pharmacology
RM1-950
spellingShingle type 2 diabetes mellitus, coronary heart disease
coronary artery bypass grafting
sodium-glucose transporter 2 inhibitors
minimally invasive extracorporeal circulation
multi-vessel coronary stenosis
over-inflammation
Therapeutics. Pharmacology
RM1-950
Celestino Sardu
Celestino Sardu
Massimo Massetti
Massimo Massetti
Nicola Testa
Luigi Di Martino
Gaetano Castellano
Fabrizio Turriziani
Ferdinando Carlo Sasso
Michele Torella
Marisa De Feo
Gaetano Santulli
Gaetano Santulli
Gaetano Santulli
Giuseppe Paolisso
Giuseppe Paolisso
Raffaele Marfella
Raffaele Marfella
Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
description Introduction: Minimally invasive extracorporeal circulation (MiECC) reduced inflammatory burden, leading to best clinical outcomes in patients treated with coronary artery bypass grafting (CABG). Despite this, the patients with type 2 diabetes mellitus (T2DM) vs those without T2DM (non-T2DM) have a worse prognosis, caused by over-inflammation and modulated by sodium-glucose transporter 2 receptors. However, we evaluated the inflammatory burden and clinical outcomes in non-T2DM vs T2DM patients under sodium-glucose transporter 2 inhibitors (SGLT2-I users) vs non-SGLT2-I users at 5 years of follow-up post-CABG via MiECC.Materials and methods: In a multicenter study, we screened consecutive patients with indications to receive CABG. The study endpoints were the inflammatory burden (circulating serum levels of tumor necrosis factor-alpha (TNF-α), interleukin 1 and 6 (IL-1 and IL-6), C-reactive protein (CRP), and leucocytes count) and the clinical outcomes at follow-up of 5 years in non-T2DM vs SGLT2-I users, in non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users.Results: At baseline, and at one year and 5 years of follow-up, the non-T2DM vs SGLT2-I users, non-T2DM vs non-SGLT2-I users, and SGLT2-I users vs non-SGLT2-I users had the lowest values of IL-1, IL-6, and TNF-α (p < 0.05). At one year of follow-up, SGLT2-I users vs non-T2DM and non-SGLT2-I users vs non-T2DM users had a higher rate of all deaths, cardiac deaths, re-myocardial infarction, repeat revascularization, and stroke, and of the composite endpoint (p < 0.05). In a multivariate Cox regression analysis, the composite endpoint was predicted by IL-1 [2.068 (1.367–3.129)], TNF-α [1.989 (1.081–2.998)], and SGLT2-I [0.504 (0.078–0.861)].Conclusion: In T2DM patients, the SGLT2-I significantly reduced the inflammatory burden and ameliorated clinical outcomes at 5 years of follow-up post-CABG via MiECC.
format article
author Celestino Sardu
Celestino Sardu
Massimo Massetti
Massimo Massetti
Nicola Testa
Luigi Di Martino
Gaetano Castellano
Fabrizio Turriziani
Ferdinando Carlo Sasso
Michele Torella
Marisa De Feo
Gaetano Santulli
Gaetano Santulli
Gaetano Santulli
Giuseppe Paolisso
Giuseppe Paolisso
Raffaele Marfella
Raffaele Marfella
author_facet Celestino Sardu
Celestino Sardu
Massimo Massetti
Massimo Massetti
Nicola Testa
Luigi Di Martino
Gaetano Castellano
Fabrizio Turriziani
Ferdinando Carlo Sasso
Michele Torella
Marisa De Feo
Gaetano Santulli
Gaetano Santulli
Gaetano Santulli
Giuseppe Paolisso
Giuseppe Paolisso
Raffaele Marfella
Raffaele Marfella
author_sort Celestino Sardu
title Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_short Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_full Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_fullStr Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_full_unstemmed Effects of Sodium-Glucose Transporter 2 Inhibitors (SGLT2-I) in Patients With Ischemic Heart Disease (IHD) Treated by Coronary Artery Bypass Grafting via MiECC: Inflammatory Burden, and Clinical Outcomes at 5 Years of Follow-Up
title_sort effects of sodium-glucose transporter 2 inhibitors (sglt2-i) in patients with ischemic heart disease (ihd) treated by coronary artery bypass grafting via miecc: inflammatory burden, and clinical outcomes at 5 years of follow-up
publisher Frontiers Media S.A.
publishDate 2021
url https://doaj.org/article/f33bf0978d55443e8ab8cb98ecd53960
work_keys_str_mv AT celestinosardu effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT celestinosardu effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT massimomassetti effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT massimomassetti effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT nicolatesta effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT luigidimartino effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT gaetanocastellano effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT fabrizioturriziani effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT ferdinandocarlosasso effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT micheletorella effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT marisadefeo effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT gaetanosantulli effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT gaetanosantulli effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT gaetanosantulli effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT giuseppepaolisso effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT giuseppepaolisso effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT raffaelemarfella effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
AT raffaelemarfella effectsofsodiumglucosetransporter2inhibitorssglt2iinpatientswithischemicheartdiseaseihdtreatedbycoronaryarterybypassgraftingviamieccinflammatoryburdenandclinicaloutcomesat5yearsoffollowup
_version_ 1718428592964108288