Update on the proteomics of male infertility: A systematic review
Objective: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozo...
Guardado en:
Autores principales: | , |
---|---|
Formato: | article |
Lenguaje: | EN |
Publicado: |
Taylor & Francis Group
2018
|
Materias: | |
Acceso en línea: | https://doaj.org/article/fbd696abc9f24f008eeea3693391fd4a |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:doaj.org-article:fbd696abc9f24f008eeea3693391fd4a |
---|---|
record_format |
dspace |
spelling |
oai:doaj.org-article:fbd696abc9f24f008eeea3693391fd4a2021-12-02T13:03:31ZUpdate on the proteomics of male infertility: A systematic review2090-598X10.1016/j.aju.2017.11.016https://doaj.org/article/fbd696abc9f24f008eeea3693391fd4a2018-03-01T00:00:00Zhttp://www.sciencedirect.com/science/article/pii/S2090598X1730150Xhttps://doaj.org/toc/2090-598XObjective: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozoa lack transcription and translation. Proteomics is considered as a major field in molecular biology to validate the target proteins in a pathophysiological state. Differential expression analysis of sperm proteins in infertile men and bioinformatics analysis offer information about their involvement in biological pathways. Materials and methods: Literature search was performed on PubMed, Medline, and Science Direct databases using the keywords ‘sperm proteomics’ and ‘male infertility’. We also reviewed the relevant cross references of retrieved articles and included them in the review process. Articles written in any language other than English were excluded. Results: Of 575 articles identified, preliminary screening for relevant studies eliminated 293 articles. At the next level of selection, from 282 studies only 80 articles related to male infertility condition met the selection criteria and were included in this review. Conclusion: In this molecular era, sperm proteomics has created a platform for enhanced understanding of male reproductive physiology as a potential tool for identification of novel protein biomarkers related to sperm function in infertile men. Therefore, it is believed that proteomic biomarkers can overcome the gaps in information from conventional semen analysis that are of limited clinical utility. Keywords: Sperm proteomics, Male infertility, Spermatozoa, Varicocele, BiomarkersManesh Kumar Panner SelvamAshok AgarwalTaylor & Francis GrouparticleDiseases of the genitourinary system. UrologyRC870-923ENArab Journal of Urology, Vol 16, Iss 1, Pp 103-112 (2018) |
institution |
DOAJ |
collection |
DOAJ |
language |
EN |
topic |
Diseases of the genitourinary system. Urology RC870-923 |
spellingShingle |
Diseases of the genitourinary system. Urology RC870-923 Manesh Kumar Panner Selvam Ashok Agarwal Update on the proteomics of male infertility: A systematic review |
description |
Objective: To assess the role of differentially expressed proteins as a resource for potential biomarker identification of infertility, as male infertility is of rising concern in reproductive medicine and evidence pertaining to its aetiology at a molecular level particularly proteomic as spermatozoa lack transcription and translation. Proteomics is considered as a major field in molecular biology to validate the target proteins in a pathophysiological state. Differential expression analysis of sperm proteins in infertile men and bioinformatics analysis offer information about their involvement in biological pathways. Materials and methods: Literature search was performed on PubMed, Medline, and Science Direct databases using the keywords ‘sperm proteomics’ and ‘male infertility’. We also reviewed the relevant cross references of retrieved articles and included them in the review process. Articles written in any language other than English were excluded. Results: Of 575 articles identified, preliminary screening for relevant studies eliminated 293 articles. At the next level of selection, from 282 studies only 80 articles related to male infertility condition met the selection criteria and were included in this review. Conclusion: In this molecular era, sperm proteomics has created a platform for enhanced understanding of male reproductive physiology as a potential tool for identification of novel protein biomarkers related to sperm function in infertile men. Therefore, it is believed that proteomic biomarkers can overcome the gaps in information from conventional semen analysis that are of limited clinical utility. Keywords: Sperm proteomics, Male infertility, Spermatozoa, Varicocele, Biomarkers |
format |
article |
author |
Manesh Kumar Panner Selvam Ashok Agarwal |
author_facet |
Manesh Kumar Panner Selvam Ashok Agarwal |
author_sort |
Manesh Kumar Panner Selvam |
title |
Update on the proteomics of male infertility: A systematic review |
title_short |
Update on the proteomics of male infertility: A systematic review |
title_full |
Update on the proteomics of male infertility: A systematic review |
title_fullStr |
Update on the proteomics of male infertility: A systematic review |
title_full_unstemmed |
Update on the proteomics of male infertility: A systematic review |
title_sort |
update on the proteomics of male infertility: a systematic review |
publisher |
Taylor & Francis Group |
publishDate |
2018 |
url |
https://doaj.org/article/fbd696abc9f24f008eeea3693391fd4a |
work_keys_str_mv |
AT maneshkumarpannerselvam updateontheproteomicsofmaleinfertilityasystematicreview AT ashokagarwal updateontheproteomicsofmaleinfertilityasystematicreview |
_version_ |
1718393544157167616 |