El virus C de la hepatitis y las enfermedades que produce

In 1989, the main agent causing non A non B hepatitis was identified as a RNA virus of the flavivirus family, with several serotypes, and was denominated virus C. At the present moment, the knowledge about the infection features and diseases that it causes has expanded thanks to the availability of...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Armas-Merino,Rodolfo, Wolff F,Carlos, Soto H,Ramón, Jirón V,M Isabel, Parraguez A,Adriana
Lenguaje:	Spanish / Castilian
Publicado:	Sociedad Médica de Santiago 1999
Materias:	Hepatitis Chronic Active Hepatitis C Viruses Interferons Liver Transplantation
Acceso en línea:	http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0034-98871999001000013
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:scielo:S0034-98871999001000013
record_format	dspace
spelling	oai:scielo:S0034-988719990010000132000-03-10El virus C de la hepatitis y las enfermedades que produceArmas-Merino,RodolfoWolff F,CarlosSoto H,RamónJirón V,M IsabelParraguez A,Adriana Hepatitis Chronic Active Hepatitis C Viruses Interferons Liver Transplantation In 1989, the main agent causing non A non B hepatitis was identified as a RNA virus of the flavivirus family, with several serotypes, and was denominated virus C. At the present moment, the knowledge about the infection features and diseases that it causes has expanded thanks to the availability of reliable laboratory techniques to detect the antibody and the virus. The prevalence of infection and the frequency of serotypes varies in different regions of the world. Chile is a country with a low prevalence. The detection of infected blood in blood banks has reduced the spreading of the disease. Other means of infection such as the use of intravenous drugs, hemodialysis and transplantation have acquired greater importance. Sexual, maternal and familial transmission is exceptional. Infected people develop an acute hepatitis, generally asymptomatic. Eighty percent remain with a chronic hepatic disease, that can be mild or progressive, evolving to cirrhosis or hepatic carcinoma. Chronic hepatitis, closely resembling an autoimmune disease, can be caused by the virus. Alcohol intake increases viral activity causing severe hepatic diseases, refractory to treatments. Several non hepatic diseases are associated to hepatitis C virus infection such as essential mixed cryoglobulinemia, mesangiocapillary glomerulonephritis, porphyria cutanea tarda, dysglobulinemias and probably type 2 diabetes mellitus. The only available treatment is interferon, that is successful in a minority of patients, frequently causing a transient improvement. The use of Ribaravine associated to interferon improve the effectiveness of therapy. Liver transplantation is the only therapy for severe hepatic disease. The use of new antiviral drugs should improve the prognosis of the disease.info:eu-repo/semantics/openAccessSociedad Médica de SantiagoRevista médica de Chile v.127 n.10 19991999-10-01text/htmlhttp://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0034-98871999001000013es10.4067/S0034-98871999001000013
institution	Scielo Chile
collection	Scielo Chile
language	Spanish / Castilian
topic	Hepatitis Chronic Active Hepatitis C Viruses Interferons Liver Transplantation
spellingShingle	Hepatitis Chronic Active Hepatitis C Viruses Interferons Liver Transplantation Armas-Merino,Rodolfo Wolff F,Carlos Soto H,Ramón Jirón V,M Isabel Parraguez A,Adriana El virus C de la hepatitis y las enfermedades que produce
description	In 1989, the main agent causing non A non B hepatitis was identified as a RNA virus of the flavivirus family, with several serotypes, and was denominated virus C. At the present moment, the knowledge about the infection features and diseases that it causes has expanded thanks to the availability of reliable laboratory techniques to detect the antibody and the virus. The prevalence of infection and the frequency of serotypes varies in different regions of the world. Chile is a country with a low prevalence. The detection of infected blood in blood banks has reduced the spreading of the disease. Other means of infection such as the use of intravenous drugs, hemodialysis and transplantation have acquired greater importance. Sexual, maternal and familial transmission is exceptional. Infected people develop an acute hepatitis, generally asymptomatic. Eighty percent remain with a chronic hepatic disease, that can be mild or progressive, evolving to cirrhosis or hepatic carcinoma. Chronic hepatitis, closely resembling an autoimmune disease, can be caused by the virus. Alcohol intake increases viral activity causing severe hepatic diseases, refractory to treatments. Several non hepatic diseases are associated to hepatitis C virus infection such as essential mixed cryoglobulinemia, mesangiocapillary glomerulonephritis, porphyria cutanea tarda, dysglobulinemias and probably type 2 diabetes mellitus. The only available treatment is interferon, that is successful in a minority of patients, frequently causing a transient improvement. The use of Ribaravine associated to interferon improve the effectiveness of therapy. Liver transplantation is the only therapy for severe hepatic disease. The use of new antiviral drugs should improve the prognosis of the disease.
author	Armas-Merino,Rodolfo Wolff F,Carlos Soto H,Ramón Jirón V,M Isabel Parraguez A,Adriana
author_facet	Armas-Merino,Rodolfo Wolff F,Carlos Soto H,Ramón Jirón V,M Isabel Parraguez A,Adriana
author_sort	Armas-Merino,Rodolfo
title	El virus C de la hepatitis y las enfermedades que produce
title_short	El virus C de la hepatitis y las enfermedades que produce
title_full	El virus C de la hepatitis y las enfermedades que produce
title_fullStr	El virus C de la hepatitis y las enfermedades que produce
title_full_unstemmed	El virus C de la hepatitis y las enfermedades que produce
title_sort	el virus c de la hepatitis y las enfermedades que produce
publisher	Sociedad Médica de Santiago
publishDate	1999
url	http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0034-98871999001000013
work_keys_str_mv	AT armasmerinorodolfo elviruscdelahepatitisylasenfermedadesqueproduce AT wolfffcarlos elviruscdelahepatitisylasenfermedadesqueproduce AT sotohramon elviruscdelahepatitisylasenfermedadesqueproduce AT jironvmisabel elviruscdelahepatitisylasenfermedadesqueproduce AT parraguezaadriana elviruscdelahepatitisylasenfermedadesqueproduce
_version_	1718435886462402560

El virus C de la hepatitis y las enfermedades que produce

Ejemplares similares