Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
Guardado en:
Autor principal: | |
---|---|
Lenguaje: | Spanish / Castilian |
Publicado: |
Sociedad Chilena de Infectología
2003
|
Acceso en línea: | http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0716-10182003000300010 |
Etiquetas: |
Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
|
id |
oai:scielo:S0716-10182003000300010 |
---|---|
record_format |
dspace |
spelling |
oai:scielo:S0716-101820030003000102003-09-09Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.Zamorano R,Juanitainfo:eu-repo/semantics/openAccessSociedad Chilena de InfectologíaRevista chilena de infectología v.20 n.3 20032003-01-01text/htmlhttp://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0716-10182003000300010es10.4067/S0716-10182003000300010 |
institution |
Scielo Chile |
collection |
Scielo Chile |
language |
Spanish / Castilian |
author |
Zamorano R,Juanita |
spellingShingle |
Zamorano R,Juanita Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46. |
author_facet |
Zamorano R,Juanita |
author_sort |
Zamorano R,Juanita |
title |
Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46. |
title_short |
Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46. |
title_full |
Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46. |
title_fullStr |
Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46. |
title_full_unstemmed |
Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46. |
title_sort |
decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. whitney cg, farley mm, hadler j, harrison lh, bennettnm, lynfield r, reingold a, cieslak pr, pilishvili t, jackson d, facklam rr, jorgensen jh and schuchat a, active bacterial core surveillance of the emerging infections program network. n engl j med 2003 may 1; 348 (18): 1737-46. |
publisher |
Sociedad Chilena de Infectología |
publishDate |
2003 |
url |
http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0716-10182003000300010 |
work_keys_str_mv |
AT zamoranorjuanita declineininvasivepneumococcaldiseaseaftertheintroductionofproteinpolysaccharideconjugatevaccinewhitneycgfarleymmhadlerjharrisonlhbennettnmlynfieldrreingoldacieslakprpilishvilitjacksondfacklamrrjorgensenjhandschuchataactivebacterialcoresurveillanceoftheeme |
_version_ |
1718440010133274624 |