Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.

Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.

Guardado en:
Detalles Bibliográficos
Autor principal: Zamorano R,Juanita
Lenguaje:Spanish / Castilian
Publicado: Sociedad Chilena de Infectología 2003
Acceso en línea:http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0716-10182003000300010
Etiquetas: Agregar Etiqueta
Sin Etiquetas, Sea el primero en etiquetar este registro!
id oai:scielo:S0716-10182003000300010
record_format dspace
spelling oai:scielo:S0716-101820030003000102003-09-09Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.Zamorano R,Juanitainfo:eu-repo/semantics/openAccessSociedad Chilena de InfectologíaRevista chilena de infectología v.20 n.3 20032003-01-01text/htmlhttp://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0716-10182003000300010es10.4067/S0716-10182003000300010
institution Scielo Chile
collection Scielo Chile
language Spanish / Castilian
author Zamorano R,Juanita
spellingShingle Zamorano R,Juanita
Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
author_facet Zamorano R,Juanita
author_sort Zamorano R,Juanita
title Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
title_short Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
title_full Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
title_fullStr Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
title_full_unstemmed Decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. Whitney CG, Farley MM, Hadler J, Harrison LH, BennettNM, Lynfield R, Reingold A, Cieslak PR, Pilishvili T, Jackson D, Facklam RR, Jorgensen JH and Schuchat A, Active Bacterial Core Surveillance of the Emerging Infections Program Network. N Engl J Med 2003 May 1; 348 (18): 1737-46.
title_sort decline in invasive pneumococcal disease after the introduction of protein-polysaccharide conjugate vaccine. whitney cg, farley mm, hadler j, harrison lh, bennettnm, lynfield r, reingold a, cieslak pr, pilishvili t, jackson d, facklam rr, jorgensen jh and schuchat a, active bacterial core surveillance of the emerging infections program network. n engl j med 2003 may 1; 348 (18): 1737-46.
publisher Sociedad Chilena de Infectología
publishDate 2003
url http://www.scielo.cl/scielo.php?script=sci_arttext&pid=S0716-10182003000300010
work_keys_str_mv AT zamoranorjuanita declineininvasivepneumococcaldiseaseaftertheintroductionofproteinpolysaccharideconjugatevaccinewhitneycgfarleymmhadlerjharrisonlhbennettnmlynfieldrreingoldacieslakprpilishvilitjacksondfacklamrrjorgensenjhandschuchataactivebacterialcoresurveillanceoftheeme
_version_ 1718440010133274624

Ejemplares similares