Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling

Enantioselective substitution reactions of racemic alkyl halides are inherently limited by the specificity of their stereochemical course (SN1 or SN2). Here, the authors report a radical coupling strategy for the enantioselective aminoalkylation of α-bromoketones for modular, highly enantioselective...

Descripción completa

Guardado en:

Detalles Bibliográficos
Autores principales:	Jiangtao Li, Manman Kong, Baokun Qiao, Richmond Lee, Xiaowei Zhao, Zhiyong Jiang
Formato:	article
Lenguaje:	EN
Publicado:	Nature Portfolio 2018
Materias:	Science Q
Acceso en línea:	https://doaj.org/article/620596de496643598b0abf1cf4e483fc
Etiquetas:	Agregar Etiqueta Sin Etiquetas, Sea el primero en etiquetar este registro!

id	oai:doaj.org-article:620596de496643598b0abf1cf4e483fc
record_format	dspace
spelling	oai:doaj.org-article:620596de496643598b0abf1cf4e483fc2021-12-02T14:40:45ZFormal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling10.1038/s41467-018-04885-32041-1723https://doaj.org/article/620596de496643598b0abf1cf4e483fc2018-06-01T00:00:00Zhttps://doi.org/10.1038/s41467-018-04885-3https://doaj.org/toc/2041-1723Enantioselective substitution reactions of racemic alkyl halides are inherently limited by the specificity of their stereochemical course (SN1 or SN2). Here, the authors report a radical coupling strategy for the enantioselective aminoalkylation of α-bromoketones for modular, highly enantioselective Csp3−Csp3 bond formation.Jiangtao LiManman KongBaokun QiaoRichmond LeeXiaowei ZhaoZhiyong JiangNature PortfolioarticleScienceQENNature Communications, Vol 9, Iss 1, Pp 1-9 (2018)
institution	DOAJ
collection	DOAJ
language	EN
topic	Science Q
spellingShingle	Science Q Jiangtao Li Manman Kong Baokun Qiao Richmond Lee Xiaowei Zhao Zhiyong Jiang Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
description	Enantioselective substitution reactions of racemic alkyl halides are inherently limited by the specificity of their stereochemical course (SN1 or SN2). Here, the authors report a radical coupling strategy for the enantioselective aminoalkylation of α-bromoketones for modular, highly enantioselective Csp3−Csp3 bond formation.
format	article
author	Jiangtao Li Manman Kong Baokun Qiao Richmond Lee Xiaowei Zhao Zhiyong Jiang
author_facet	Jiangtao Li Manman Kong Baokun Qiao Richmond Lee Xiaowei Zhao Zhiyong Jiang
author_sort	Jiangtao Li
title	Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
title_short	Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
title_full	Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
title_fullStr	Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
title_full_unstemmed	Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
title_sort	formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling
publisher	Nature Portfolio
publishDate	2018
url	https://doaj.org/article/620596de496643598b0abf1cf4e483fc
work_keys_str_mv	AT jiangtaoli formalenantioconvergentsubstitutionofalkylhalidesviacatalyticasymmetricphotoredoxradicalcoupling AT manmankong formalenantioconvergentsubstitutionofalkylhalidesviacatalyticasymmetricphotoredoxradicalcoupling AT baokunqiao formalenantioconvergentsubstitutionofalkylhalidesviacatalyticasymmetricphotoredoxradicalcoupling AT richmondlee formalenantioconvergentsubstitutionofalkylhalidesviacatalyticasymmetricphotoredoxradicalcoupling AT xiaoweizhao formalenantioconvergentsubstitutionofalkylhalidesviacatalyticasymmetricphotoredoxradicalcoupling AT zhiyongjiang formalenantioconvergentsubstitutionofalkylhalidesviacatalyticasymmetricphotoredoxradicalcoupling
_version_	1718390176761249792

Formal enantioconvergent substitution of alkyl halides via catalytic asymmetric photoredox radical coupling

Ejemplares similares